KEGG   Canis familiaris (dog): 478910Help
Entry
478910            CDS       T01007                                 

Gene name
PLCD4
Definition
phospholipase C, delta 4
Orthology
K05857  
phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
cfa  Canis familiaris (dog)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Calcium signaling pathway
Phosphatidylinositol signaling system
Thyroid hormone signaling pathway
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    478910 (PLCD4)
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    478910 (PLCD4)
   04070 Phosphatidylinositol signaling system
    478910 (PLCD4)
 Organismal Systems
  Endocrine system
   04919 Thyroid hormone signaling pathway
    478910 (PLCD4)
Enzymes [BR:cfa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     478910 (PLCD4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
37
AA seq 799 aa AA seqDB search
MASLMQSRLPINQDLMLMQKGMLMRKVRSKCWKKLRYFRLQDDGMTVWHARQEGGNAKPT
FSISDVETVREGHESELLRSLAEEFPLERGFTIIFHGRRANLDLVANSVEEAEVWKRGLW
HLMDFVNGMDQQERLDQWLSDWFQRGDKNQDGRMSFQEVQRLLHLMNVEMDQEYAFHLFQ
TADTSHSGTLEGEEFVDFYKALTKRAEVQELFENFSADGQKLTLLEFVDFLREEQKEGER
APDLALELIDRYEPSESGKLRHVLSMDGFLSYLCSKDGDIFKPTCLPIYQDMTQPLNNYY
INSSHNTYLVGDQLYGQSSVEGYIRALKRGCRCVEVDIWDGPSGEPIVYHGHTLTSRIPF
KDVVATVAQYAFQTSEYPVILSLENHCSWEQQQVMACHLTEILGEQLLSTTLDGLLPTQL
PSPEELRRKILVKGKKLRTLEEDLEEEEEEELESELEGEQEADPEPEAQLESEPQELSPR
SKDKKKEKVVMCPLFCPPTCCEVMVQAPFSKPKSLLFPKQKSKPILCPSLSALVVYLKSV
SFHSFTHSREHYRFYETSSFSETKAKSLIKEAGNEFVQHNAWQLSRVYPSGLRTDSSNYN
PQELWNAGCQMVAMNVQTAGLEMDICDGLFRQNGGCGYVLKPDFLRDAQSSFHPERPVSP
FRAQTLLIQVISGQQLPKEDMSKERSIVDPLVRVEIFGVRPDTTRQETSYVENNGFNPYW
GQTLCFRVLVPELALLRFVVKDYNWKSRNDFIGQYTLPWTCMQQGYRHIHLLSKDGTSLH
PASIFVHINIREGLEGDEC
NT seq 2400 nt NT seq  +upstreamnt  +downstreamnt
atggcgtctctgatgcaaagccggttgcctatcaatcaagacctgatgctgatgcagaag
ggcatgctgatgcgcaaggtgagatccaaatgctggaagaaactaagatacttcagactt
caagatgatggcatgacagtctggcatgcccggcaggaaggaggcaatgccaagcccacc
ttctcaatctctgatgtggagacagtacgtgagggccatgagtctgagctgctacgcagc
ctggcagaggagttccccctggagcggggcttcaccatcatcttccacggccgccgtgcc
aacctggacctggtggccaacagtgtcgaggaggccgaggtatggaagcgggggctctgg
catctgatggactttgtcaacggcatggaccaacaggagcggctggaccaatggctgagt
gactggttccagcgtggagacaagaaccaggatggtcggatgagtttccaagaagtccag
cgattactgcacctgatgaatgtggaaatggatcaagaatatgccttccatcttttccaa
acagcagacacgtcccattctgggaccctggaaggagaagaatttgtagacttctataag
gcgctgactaaacgtgctgaggtgcaggagctgtttgaaaacttttcggctgatgggcag
aagctgaccctgctggaatttgtggatttcctccgagaggagcagaaagaaggagaacga
gctcctgaccttgctctggaactcatcgaccgctatgagccctcagagagcggtaaattg
cgacatgtgctgagcatggatggcttcctcagctacctctgctcaaaggacggagatatc
ttcaagccgacctgcctccccatctaccaggatatgactcaacccctgaacaactactac
atcaactcctctcacaacacttacctcgtgggggaccagctttatggccagagcagcgtc
gagggatatatacgggccctgaagagggggtgccgctgcgtggaggtggatatatgggat
ggacctagcggggaacctattgtttaccatggacacaccctgacttcccgcatcccattc
aaagatgtcgtggccactgtagcacagtatgccttccagacatccgaatacccggtcatc
ttgtccctggagaaccactgcagctgggagcagcagcaggtcatggcatgccatctgacc
gagatcttgggggagcagctgctgagcaccaccttggacgggctgctgcccactcagctg
ccctcacctgaggagcttcggaggaagatcctggtgaaggggaagaagttaaggacactt
gaggaggatcttgaggaagaggaagaggaggagctagaatctgaactggagggggagcag
gaggctgacccagagccagaggcccagttggagtctgagccccaggagttgagtccacgt
agtaaggacaaaaagaaggagaaggttgtgatgtgtccgctgttttgtccgcctacctgt
tgtgaggttatggttcaggctcctttttccaagcctaagtccctcctctttcccaagcag
aaatccaaacccatcttgtgcccatccctctctgccctggttgtctacttgaagtcggtc
tcattccacagcttcactcattcgagggagcactaccgcttctatgagacatcatctttc
tctgaaaccaaggccaagagcctcatcaaggaggctggcaatgagttcgtgcagcacaac
gcctggcagttaagccgtgtgtatcccagtggcctgaggacggattcgtccaactacaac
ccccaggaactctggaatgcaggctgccagatggtggccatgaacgtgcagaccgcgggg
ctggagatggacatctgtgacgggctcttccgccagaacggtggctgcggctatgtgctg
aagccagacttcctgcgcgatgcccagagttccttccaccctgagaggcccgtcagccct
ttcagagcccagaccctcctcatccaggtgatcagtgggcagcaactccccaaggaggac
atgtctaaagagcggtccattgtggatccactggtgagagtagagatctttggcgtccgc
ccggacacaacccggcaagagaccagctacgtggagaacaacggttttaatccatactgg
gggcagacactatgcttccgggtcctggtgcctgaactggccctgctgcgtttcgtggtc
aaggattacaactggaaatcccgaaatgattttatcgggcagtacacactaccttggacc
tgcatgcagcaaggctaccgccacatacacctgctctccaaggatggcaccagcctccac
ccagcttccatcttcgtgcatatcaacatccgggaagggctggagggggatgaatgctaa

DBGET integrated database retrieval system