KEGG   Canis familiaris (dog): 478958Help
Entry
478958            CDS       T01007                                 

Gene name
UCHL5
Definition
ubiquitin carboxyl-terminal hydrolase L5
Orthology
K05610  
ubiquitin carboxyl-terminal hydrolase L5 [EC:3.4.19.12]
Organism
cfa  Canis familiaris (dog)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
38
AA seq 328 aa AA seqDB search
MTGNAGEWCLMESDPGVFTELIKGFGCRGAQVEEIWSLEPENFEKLKPVHGLIFLFKWQP
GEEPAGSVVQDSRLDTIFFAKQVINNACATQAIVSVLLNCTHQDVHLGETLSEFKEFSQS
FDAAMKGLALSNSDVIRQVHNSFARQQMFEFDAKTSAKEEDAFHFVSYVPVNGRLYELDG
LREGPIDLGACNQDDWISAVRPVIEKRIQKYSEGEIRFNLMAIVSDRKMIYEQKIAELQR
QLAEEPMDTDQGNNMLSAIQSEVAKNQMLIEEEVQKLKRYKIENIRRKHNYLPFIMELLK
TLAEHQQLIPLVEKAKEKQNAKKAQETK
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgacgggcaatgccggggagtggtgcctcatggagagcgaccccggggtcttcaccgag
ctcattaaaggattcggttgccgaggagcccaagtggaagaaatatggagtttagagcct
gagaattttgaaaaattaaagccagttcatgggttaatttttcttttcaagtggcagcca
ggagaagaaccagcaggctctgtagttcaggactccagacttgacacaatattttttgcc
aagcaggtaattaacaatgcttgtgctacccaagccatagtaagtgtgttattaaactgt
acccatcaagatgtccatttgggagagacattatcagaatttaaagaattttcacaaagt
tttgatgcagctatgaaaggtttggcactaagcaattcagatgtgattcgacaagtacac
aacagttttgccagacagcagatgtttgaatttgatgcaaagacatcagcaaaagaagaa
gatgcttttcattttgtcagttatgttcctgtaaatggaagattgtatgaattagatgga
ttaagagaaggaccaattgatttaggtgcatgcaatcaagatgactggatcagcgcagta
aggccagtcatagaaaaaaggatacaaaagtacagtgaaggtgaaattcggtttaacttg
atggccattgtatctgacagaaaaatgatatatgaacagaagatagccgagttacaaaga
caacttgctgaggaacccatggatacagaccagggcaataatatgctaagtgctattcag
tcagaggttgccaaaaatcagatgcttattgaagaagaagtacagaaactaaaaagatat
aagattgaaaatatcagaaggaagcataattacctgcctttcattatggaattattaaag
actttagcagaacaccagcagttaattccactagtagaaaaggcaaaagaaaaacagaat
gcaaagaaagcacaggaaaccaaatga

DBGET integrated database retrieval system