KEGG   Canis familiaris (dog): 478979Help
Entry
478979            CDS       T01007                                 

Gene name
USP21
Definition
ubiquitin specific peptidase 21
Orthology
K11833  
ubiquitin carboxyl-terminal hydrolase 2/21 [EC:3.1.2.15]
Organism
cfa  Canis familiaris (dog)
Brite
Enzymes [BR:cfa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     478979 (USP21)
Peptidases [BR:cfa01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   478979 (USP21)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
38
AA seq 565 aa AA seqDB search
MPQASEHRLGRTREPPVNVQPRVGSKLPFAPRARSKERRNPAPGPNPMLRPLPPRPGPPE
ERLKKLELGRGRTSGPRPRGPLRADHGVPLPGSPPPTVALPLPSRTNLARSKSVSSGDLR
PMGIALGGHRGAGELGAALSRLALRPEPPTLRRSASLRRLGGFPGPPTLLSIRTEPPTSH
GSFHVISARPSESFYSDDKMAHHTLLLGSGHVGLRNLGNTCFLNAVLQCLSSTRPLRDFC
LRRDFRQEVPGGGRAQELTEAFADVIGALWHPDSCEAVNPTRFRAVFQKYVPSFSGYSQQ
DAQEFLKLLMERLHLEINRRGRRAPPILASSPAPAQPRRGGALLEEPELSDDDRANLMWK
RYLEREDSKIVDLFVGQLKSCLKCQACGYRSTTFEVFCDLSLPIPKKGFAGGKVSLRDCF
SLFTKEEELESENAPVCDRCRQKTRSTKKLTVQRFPRILVLHLNRFSASRGSIKKSSVGV
DFPLQRLSLGDFASDKAGSPVYQLYALCNHSGSVHYGHYTALCRCQTGWHVYNDSRVSPV
SENQVASSEGYVLFYQLMQEPPRCL
NT seq 1698 nt NT seq  +upstreamnt  +downstreamnt
atgccccaggcctctgagcaccgcctgggccggacccgagagccacccgttaatgtccag
ccacgagtgggatccaagctaccatttgccccgagggcccgaagcaaggagcgccgaaac
ccagcccctgggccgaaccccatgttaagacctctgcctccccggccaggtccccccgag
gaacggctcaagaaactggagctgggacggggccggacctcaggtcctcgtccccgagga
cccctccgggcagatcatggagttcccctgcctggctcaccacccccaactgtggctctg
cctctcccttccaggaccaacctagctcgttccaagtctgtgagcagtggggacttgcgt
cctatggggattgccttgggagggcatcgtggtgctggagagctaggggccgcgctgagc
cgcctggcgctccggcctgagcctcccaccctgagacggagcgcctctctccgccgcctc
gggggctttcctggtcctcccaccttgctcagtatacggacggagccccctacttcccat
ggctccttccacgtcatatctgcccggccctctgagtctttctactccgatgacaaaatg
gctcatcacacactgcttctgggctctggtcacgttggcctccgaaatctggggaacacg
tgcttcctgaatgcagtgctacagtgtttgagcagcactcggcctcttcgggacttctgt
ctgcgaagggacttccggcaagaggtgcctggagggggtcgagcccaagagctcactgaa
gcctttgccgatgtgattggtgccctgtggcaccctgactcctgtgaagctgtgaatcct
actcgattccgagctgtcttccagaaatacgttccctccttctctggatacagccagcag
gatgcccaagagttcctgaagctcctcatggagcggctgcaccttgaaatcaaccggcgg
ggccgccgggctccacccatcctggccagcagtccagctcccgcccagccccgtcgcgga
ggagctctgctagaagaacctgagttgagtgatgatgacagagccaacctaatgtggaag
cgttacctggagcgagaagacagcaagattgtggacctgtttgtgggccagttgaaaagt
tgtctcaagtgccaggcctgtgggtatcgctccacgaccttcgaggttttttgtgacctg
tccctgcccatccccaagaaaggatttgccgggggcaaggtgtctctgcgggattgtttc
agcctgttcaccaaggaagaagagctagagtccgagaatgctccagtgtgtgaccggtgt
cggcagaaaacgcgaagtaccaaaaagttgaccgtacaaagattcccccgaatcctcgtg
cttcatcttaatcgcttttccgcctcccgaggctccatcaagaaaagttcggtaggtgta
gacttcccgctgcagcgactgagcctgggggattttgccagcgacaaagccggaagcccc
gtgtaccagctgtacgccctctgcaaccactcgggcagcgtccactacggccactataca
gccctgtgcagatgccagactggttggcatgtctacaacgactctcgcgtgtcccccgtc
agtgaaaaccaggtggcgtccagcgagggctacgtgctgttctaccaactgatgcaggag
ccgccccggtgcctgtga

DBGET integrated database retrieval system