KEGG   Canis familiaris (dog): 478980Help
Entry
478980            CDS       T01007                                 

Gene name
PPOX
Definition
(RefSeq) protoporphyrinogen oxidase
  KO
K00231  protoporphyrinogen/coproporphyrinogen III oxidase [EC:1.3.3.4 1.3.3.15]
Organism
cfa  Canis familiaris (dog)
Pathway
cfa00860  Porphyrin and chlorophyll metabolism
cfa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    478980 (PPOX)
Enzymes [BR:cfa01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     478980 (PPOX)
    1.3.3.15  coproporphyrinogen III oxidase (coproporphyrin-forming)
     478980 (PPOX)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 DAO Thi4 FAD_binding_2 FAD_oxidored Pyr_redox_2 Lycopene_cycl
Motif
Other DBs
NCBI-GeneID: 478980
NCBI-ProteinID: XP_005640930
Ensembl: ENSCAFG00000012811
Position
38
AA seq 480 aa AA seqDB search
MGRTVVVLGGGISGLAAGYHLSRAPCAPKVVLVEGSERLGGWIRSVRGPGGAVFELGPRG
IRPAGAPGARTLLLVSELGLDSEVLPVRGDHPAAQNRFLYVGGALHALPSGLRGLFRPSP
PFSKPLFWAGLRELTTPRGKDPDETVHSFAQRRLGPEVASLAMDSLCRGVFAGNSRELSV
RSCFPSLFQAEQSHRSVLLGLLLGAASSGHSPRPDSALIRQARAERWSQWSLRGGLETLP
QALNTYLTSRGVSVLRGQPVCGLGLLPGGRWKVSLGDGSLEADHVISAVPASVLSKLLPA
QAAPLAHALSAITAVSVVVVNLQYRGARLPVQGFGHLVPSSEDPGVLGIVYDSVAFPEQD
GSPPGLRVTVMLGGSWLQTLEARGGLLSRELFQQQAQQAAATQLGLKEPPSHCLVHLHKN
CIPQYTLGHWQKLEAVTQFLASQRLPLTLAGASYEGVAVNDCIESGRRAAARVLGSEPNS
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atgggccggaccgtggtcgtgctgggcggcggcatcagcggcttggccgccggttaccac
ctgagccgggccccctgcgcccccaaggtggtcctggtggagggcagcgagcgcctggga
ggctggatccgctcggtccgaggccccggcggtgctgtctttgaacttggacctcgagga
attcggccagcgggagccccgggagcccggaccctgctcctggtctctgagcttggcttg
gactccgaagtgttgcctgtccggggagaccacccagctgcccagaacaggttcctgtac
gtgggtggcgccctgcatgcgctgccctctggcctcagggggctcttccgcccttcacct
cccttctccaaacctctgttttgggccgggctgagggagttgaccacgccccgaggcaaa
gaccctgatgagaccgtgcacagttttgcccagcgccgccttggacctgaggtggcgtct
ctggccatggacagtctctgccgaggtgtgttcgcaggcaacagccgggagctcagcgtc
aggtcctgctttcccagtctcttccaagctgagcaaagccatcgttctgttttgctgggg
ctgctgctgggggccgcctcttcagggcacagccctcgaccggactcggcgctcattcgc
caggcccgagctgagcgctggagccagtggtcactccgtggagggctggagacgttgccc
caggcccttaacacctacctgactagtagaggggtcagtgttctcagaggccagcctgtc
tgtgggctaggcctcctccctggaggccgctggaaggtatctctgggggacggcagcctg
gaggcagaccacgtgattagtgctgttccagcttcagtgctcagcaagctgctccctgcc
caggctgcgcctctggctcatgccctgagtgccatcactgccgtgtcggtggtggtggtg
aacctccagtaccgaggagctcgtctgcctgtgcagggatttggacatttggtgccatcc
tcagaagacccaggcgtcctgggaatcgtgtatgactcagttgcttttcctgagcaggat
gggagcccccctggcctccgagtgactgtgatgctgggagggtcctggttacagacgctg
gaagccaggggtggtctcttatctcgggagctgttccagcagcaggcacagcaagcagct
gccacccagttaggactaaaggagccaccaagtcactgcttggtccacctacacaagaac
tgcatcccccagtatacactaggccactggcaaaaactggaggcagtcacccagttcctg
gcttctcagaggttgcccttgactctggccggagcctcctatgagggcgttgctgtcaat
gactgtatagagagtggacggcgggcagcggctcgggtcctgggctcagaacctaacagc
tga

DBGET integrated database retrieval system