KEGG   Canis familiaris (dog): 478989Help
Entry
478989            CDS       T01007                                 

Gene name
RXRG
Definition
(RefSeq) retinoid X receptor gamma
  KO
K08526  retinoid X receptor gamma
Organism
cfa  Canis familiaris (dog)
Pathway
cfa03320  PPAR signaling pathway
cfa04659  Th17 cell differentiation
cfa04919  Thyroid hormone signaling pathway
cfa04920  Adipocytokine signaling pathway
cfa04928  Parathyroid hormone synthesis, secretion and action
cfa05200  Pathways in cancer
cfa05202  Transcriptional misregulation in cancer
cfa05216  Thyroid cancer
cfa05222  Small cell lung cancer
cfa05223  Non-small cell lung cancer
cfa05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Organismal Systems
  Immune system
   04659 Th17 cell differentiation
    478989 (RXRG)
  Endocrine system
   04920 Adipocytokine signaling pathway
    478989 (RXRG)
   03320 PPAR signaling pathway
    478989 (RXRG)
   04919 Thyroid hormone signaling pathway
    478989 (RXRG)
   04928 Parathyroid hormone synthesis, secretion and action
    478989 (RXRG)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    478989 (RXRG)
   05202 Transcriptional misregulation in cancers
    478989 (RXRG)
   05226 Gastric cancer
    478989 (RXRG)
   05216 Thyroid cancer
    478989 (RXRG)
   05222 Small cell lung cancer
    478989 (RXRG)
   05223 Non-small cell lung cancer
    478989 (RXRG)
Transcription factors [BR:cfa03000]
 Eukaryotic Type
  Zinc finger
   Cys4 hepatocyte nuclear factor 4-like
    478989 (RXRG)
Nuclear receptors [BR:cfa03310]
 2. Hepatocyte nuclear factor 4 like
  2B. Retinoid X receptor (RXR)
   478989 (RXRG)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hormone_recep Nuc_recep-AF1 zf-C4
Motif
Other DBs
NCBI-GeneID: 478989
NCBI-ProteinID: XP_005640900
Ensembl: ENSCAFG00000013336
Position
38
AA seq 504 aa AA seqDB search
MQVISIDQLPIVIHVNQQKIIPSLILSCRQVLFEHLPSSRLSAGYHDGDHSRQVEIKSSP
GHSGSTSMSPSAALSTGKPMDSHPSYTDTPVSAPRTLSAVGPPLNALGSPYRVITSAMGP
PSGALAAPPGINLVAPPSSQLNVVNSVSISEDIKPLPGLPGIGNMNYPSASPGSLVKHIC
AICGDRSSGKHYGVYSCEGCKGFFKRTIRKDLMYTCRDNKDCLIDKRQRNRCQYCRYQKC
LVMGMKREAVQEERQRSRERAESEADCANSGHEDMPVERILEAELAVEPKTESYGDMNLE
NSTNDPVTNICHAADKQLFTLVEWAKRIPHFSDLTLEDQVILLRAGWNELLIASFSHRSV
SVQDGILLATGLHVHRSSAHSAGVGSIFDRVLTELVSKMKDMQMDKSELGCLRAIVLFNP
DAKGLSNPSEVETLREKVYATLEAYTKQKYPEQPGRFAKLLLRLPALRSIGLKCLEHLFF
FKLIGDTPIDTFLMEMLETPLQIT
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgcaagtaatttctattgatcaactccctatcgtcatacacgttaatcaacaaaaaatt
atcccatctctgatcctgtcttgtcgtcaggtactttttgagcatctgccaagttccagg
ctcagtgctgggtaccatgatggtgaccattcacggcaagtggaaattaaaagctccccc
ggccactccggctccacgtccatgagcccgtcggcagccttgtccactgggaagcccatg
gacagccaccccagctacacggacacaccagtgagtgccccgcggactctgagtgcagtg
gggccccccctcaatgccctgggctctccatatcgagtcatcacgtctgccatgggcccg
ccctcgggagccctggcagcacctccaggaatcaacctggtcgccccgcccagctcccag
ctaaatgtggtcaacagtgtcagcatttcagaggacatcaagcccttgccagggcttcct
gggattggaaacatgaactacccatcagccagccctggctctctggttaaacacatctgt
gcaatctgtggggataggtcctcaggaaagcactacggtgtgtacagttgtgaaggctgc
aaagggttcttcaagagaaccataaggaaagacctcatgtacacgtgtcgcgataataaa
gactgcctcattgacaagcgccagaggaaccgctgccagtactgccgctaccagaagtgc
ctggtgatgggcatgaagagggaagctgtgcaagaagaaaggcagaggagccgggagcgg
gccgagagtgaggcagactgtgccaacagtggccatgaagatatgcctgtggagaggatt
ctagaagcggagcttgctgttgagccaaagacagaatcctatggtgatatgaacttggag
aactcgacaaatgaccctgtcaccaacatatgccatgctgctgataagcagctcttcact
cttgttgaatgggccaagcgcattccccacttctctgacctcaccttggaggaccaggtc
atcctgctccgggcagggtggaatgaattgctaattgcctccttctcccaccgctcggtc
tctgtccaggatggcattcttctggccacgggtttacacgtccaccggagcagtgcccac
agcgctggggttggctccatctttgacagagtcctgactgagctggtctccaaaatgaaa
gacatgcagatggacaagtcggagctggggtgcctgcgagccattgtgctgtttaaccca
gatgccaaggggctgtccaacccctcggaggtggagaccctgcgagagaaggtttacgcc
acccttgaggcctacaccaagcagaagtatccagaacaacctggcaggttcgccaagctg
ctgctgcgcctcccggccctgcgctccatcggcctcaagtgcctggagcacctcttcttc
ttcaagctcatcggagacacgcccatcgacaccttcctcatggagatgttggagaccccg
ctgcagatcacctga

DBGET integrated database retrieval system