KEGG   Canis familiaris (dog): 479075Help
Entry
479075            CDS       T01007                                 

Gene name
GRK4
Definition
G protein-coupled receptor kinase 4
Orthology
K08291  
G protein-coupled receptor kinase [EC:2.7.11.16]
Organism
cfa  Canis familiaris (dog)
Pathway
Chemokine signaling pathway
Endocytosis
Morphine addiction
Class
Cellular Processes; Transport and catabolism; Endocytosis [PATH:cfa04144]
Organismal Systems; Immune system; Chemokine signaling pathway [PATH:cfa04062]
Human Diseases; Substance dependence; Morphine addiction [PATH:cfa05032]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
3
AA seq 634 aa AA seqDB search
MAKPPGRDAGSLRKRVREPGSRTALVPREPAAAPPAPSPLPGARGPRRRRRRRRRRAVEL
ENLVANTLLLKARQGGGYGKKSGRSKRWREMLKLPPVSQCRELRHSIEKDYSSLCDKQPI
GRLLFRQFCDTKYDLKGCIEFLDAVGEYEVTADEDQRSYGLQVFNTFFSVESAVPLPEIP
SRVLRECWLKLKENPDKDVFEECTSFVHYYLSGEPFEEYLESPYFSRFLQWKWLERQPVT
KNTFRNYRVLGKGGFGEVCACQVRATGRMYACKKLEKKRIKKRKGEAMALNEKRMLEKVH
SRFVVSLSYTYETKDSLCLVLTIMNGGDLKFHIHNLGNPGFDEQRAIFYAAELCCGLEDL
QKERIVYRDLKPENILLDDRGHIRISDLGLAMEIPEGETIRGRVGTVGYMAPEVINNENY
TFSPDWWGLGCLIYEMIQGHSPFRKFKEKVKREEVERRVKKDTEEYSKKFSEDSKSICKM
LLTKNPKHRLGCKAGAVEVKGHPVFKDINFKRLEANMLDPPFCPDPQAVYCKDILDIEQF
STVRGVYLDTNDDMFYGQFATGCVSIPWQNEMIESGCFNDINKDEFDENTVLNLEEKMHY
QVPKKKRGFFYRLLRRGGCISSGPSEKEELPPRL
NT seq 1905 nt NT seq  +upstreamnt  +downstreamnt
atggcgaagcccccaggccgcgacgccgggtccctccgcaagcgcgtgcgggaacccggg
agccgcaccgccctcgtcccgcgagaacctgcggcggcgccccccgccccctccccgctt
cctggggcccgcggaccccggcggcggcggcggcggcggcggcggcgggccgtggagctg
gagaacctcgtggccaacacgctgctgctgaaagcgcgccaaggaggaggatatggcaaa
aaaagtggccgtagtaaaagatggagggaaatgctgaagctgcctcctgtcagccagtgc
agagagcttagacattctattgaaaaggattatagcagtctttgtgacaagcagcccata
ggaagacttctcttcaggcaattctgtgatacaaaatatgatctaaagggatgcatcgaa
ttcctggatgcagtgggagagtatgaagtgaccgctgatgaggaccaaagaagctatgga
ctgcaggtcttcaacacgttcttcagtgtcgagtcagcagtccctttaccagaaataccc
tcacgtgttttgagagaatgttggttgaaactgaaggagaaccctgacaaggacgtcttt
gaggaatgcaccagttttgtccattactatttaagtggagaaccatttgaagaataccta
gaaagcccatatttttcccgatttctacagtggaaatggttggaaaggcaaccagtaaca
aagaacacatttagaaattacagagttctaggaaaaggcggatttggagaggtttgtgcc
tgtcaagtgcgagctacaggaaggatgtatgcctgtaaaaagctagagaaaaaaagaata
aagaagaggaaaggtgaagccatggctcttaatgaaaagagaatgctagaaaaagtgcat
agcagatttgtagttagtttgtcctacacttatgaaaccaaagattccttgtgcttggtg
ctaaccattatgaatggaggggacttgaagtttcacatccacaacctgggaaaccctggc
tttgatgagcagagagctattttctatgctgctgagctatgctgtggcttggaggacttg
cagaaggaaagaattgtgtacagagacttaaagcctgagaatattctcctcgatgaccgt
gggcacatccggatctcagacctcggtttagccatggagattccggaaggggagaccatc
cgaggaagagtgggtacagtcggctacatggctcctgaagttatcaataatgaaaactat
acatttagtcctgattggtggggacttggctgtctgatatatgaaatgattcagggacat
tctccattcagaaagttcaaagagaaagtcaagcgagaggaggtggaacgaagagtgaag
aaagacactgaggagtattcgaagaagttttctgaggactccaagtccatctgcaagatg
ttactcaccaagaatcccaaacatcgactaggctgcaaggctggagcagtggaggtaaaa
ggacaccccgtgttcaaggacattaacttcaagagactggaagcgaatatgttagatcct
ccattctgccctgatccacaagccgtttactgtaaggacatactggatatagagcagttc
tctaccgtgagaggagtctacctggacaccaatgatgacatgttctatggtcaatttgct
acagggtgtgtctccatcccctggcagaatgagatgattgaatcaggttgttttaatgac
atcaacaaagatgagtttgatgaaaacacggtgttgaatctagaagagaaaatgcattac
caggttcccaaaaagaagagaggcttcttctacagactcctcaggagagggggctgcatt
agcagtggccccagcgaaaaggaagagctgcccccaaggctgtga

DBGET integrated database retrieval system