KEGG   Canis familiaris (dog): 479075Help
Entry
479075            CDS       T01007                                 

Gene name
GRK4
Definition
G protein-coupled receptor kinase 4
Orthology
K08291  
G protein-coupled receptor kinase [EC:2.7.11.16]
Organism
cfa  Canis familiaris (dog)
Pathway
Chemokine signaling pathway
Endocytosis
Morphine addiction
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    479075 (GRK4)
 Organismal Systems
  Immune system
   04062 Chemokine signaling pathway
    479075 (GRK4)
 Human Diseases
  Substance dependence
   05032 Morphine addiction
    479075 (GRK4)
Enzymes [BR:cfa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.16  G-protein-coupled receptor kinase
     479075 (GRK4)
Protein kinases [BR:cfa01001]
 Serine/threonine protein kinases: AGC group
  GRK family [OT]
   479075 (GRK4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
3
AA seq 634 aa AA seqDB search
MAKPPGRDAGSLRKRVREPGSRTALVPREPAAAPPAPSPLPGARGPRRRRRRRRRRAVEL
ENLVANTLLLKARQGGGYGKKSGRSKRWREMLKLPPVSQCRELRHSIEKDYSSLCDKQPI
GRLLFRQFCDTKYDLKGCIEFLDAVGEYEVTADEDQRSYGLQVFNTFFSVESAVPLPEIP
SRVLRECWLKLKENPDKDVFEECTSFVHYYLSGEPFEEYLESPYFSRFLQWKWLERQPVT
KNTFRNYRVLGKGGFGEVCACQVRATGRMYACKKLEKKRIKKRKGEAMALNEKRMLEKVH
SRFVVSLSYTYETKDSLCLVLTIMNGGDLKFHIHNLGNPGFDEQRAIFYAAELCCGLEDL
QKERIVYRDLKPENILLDDRGHIRISDLGLAMEIPEGETIRGRVGTVGYMAPEVINNENY
TFSPDWWGLGCLIYEMIQGHSPFRKFKEKVKREEVERRVKKDTEEYSKKFSEDSKSICKM
LLTKNPKHRLGCKAGAVEVKGHPVFKDINFKRLEANMLDPPFCPDPQAVYCKDILDIEQF
STVRGVYLDTNDDMFYGQFATGCVSIPWQNEMIESGCFNDINKDEFDENTVLNLEEKMHY
QVPKKKRGFFYRLLRRGGCISSGPSEKEELPPRL
NT seq 1905 nt NT seq  +upstreamnt  +downstreamnt
atggcgaagcccccaggccgcgacgccgggtccctccgcaagcgcgtgcgggaacccggg
agccgcaccgccctcgtcccgcgagaacctgcggcggcgccccccgccccctccccgctt
cctggggcccgcggaccccggcggcggcggcggcggcggcggcggcgggccgtggagctg
gagaacctcgtggccaacacgctgctgctgaaagcgcgccaaggaggaggatatggcaaa
aaaagtggccgtagtaaaagatggagggaaatgctgaagctgcctcctgtcagccagtgc
agagagcttagacattctattgaaaaggattatagcagtctttgtgacaagcagcccata
ggaagacttctcttcaggcaattctgtgatacaaaatatgatctaaagggatgcatcgaa
ttcctggatgcagtgggagagtatgaagtgaccgctgatgaggaccaaagaagctatgga
ctgcaggtcttcaacacgttcttcagtgtcgagtcagcagtccctttaccagaaataccc
tcacgtgttttgagagaatgttggttgaaactgaaggagaaccctgacaaggacgtcttt
gaggaatgcaccagttttgtccattactatttaagtggagaaccatttgaagaataccta
gaaagcccatatttttcccgatttctacagtggaaatggttggaaaggcaaccagtaaca
aagaacacatttagaaattacagagttctaggaaaaggcggatttggagaggtttgtgcc
tgtcaagtgcgagctacaggaaggatgtatgcctgtaaaaagctagagaaaaaaagaata
aagaagaggaaaggtgaagccatggctcttaatgaaaagagaatgctagaaaaagtgcat
agcagatttgtagttagtttgtcctacacttatgaaaccaaagattccttgtgcttggtg
ctaaccattatgaatggaggggacttgaagtttcacatccacaacctgggaaaccctggc
tttgatgagcagagagctattttctatgctgctgagctatgctgtggcttggaggacttg
cagaaggaaagaattgtgtacagagacttaaagcctgagaatattctcctcgatgaccgt
gggcacatccggatctcagacctcggtttagccatggagattccggaaggggagaccatc
cgaggaagagtgggtacagtcggctacatggctcctgaagttatcaataatgaaaactat
acatttagtcctgattggtggggacttggctgtctgatatatgaaatgattcagggacat
tctccattcagaaagttcaaagagaaagtcaagcgagaggaggtggaacgaagagtgaag
aaagacactgaggagtattcgaagaagttttctgaggactccaagtccatctgcaagatg
ttactcaccaagaatcccaaacatcgactaggctgcaaggctggagcagtggaggtaaaa
ggacaccccgtgttcaaggacattaacttcaagagactggaagcgaatatgttagatcct
ccattctgccctgatccacaagccgtttactgtaaggacatactggatatagagcagttc
tctaccgtgagaggagtctacctggacaccaatgatgacatgttctatggtcaatttgct
acagggtgtgtctccatcccctggcagaatgagatgattgaatcaggttgttttaatgac
atcaacaaagatgagtttgatgaaaacacggtgttgaatctagaagagaaaatgcattac
caggttcccaaaaagaagagaggcttcttctacagactcctcaggagagggggctgcatt
agcagtggccccagcgaaaaggaagagctgcccccaaggctgtga

DBGET integrated database retrieval system