KEGG   Canis familiaris (dog): 479079Help
Entry
479079            CDS       T01007                                 

Gene name
TACC3
Definition
(RefSeq) transforming, acidic coiled-coil containing protein 3
  KO
K14283  
transforming acidic coiled-coil-containing protein 3
Organism
cfa  Canis familiaris (dog)
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    479079 (TACC3)
Messenger RNA biogenesis [BR:cfa03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     479079 (TACC3)
   mRNA cycle factors
    P-body specific factors
     479079 (TACC3)
Chromosome [BR:cfa03036]
 Eukaryotic Type
  Sister chromatid separation proteins
   TACC proteins
    479079 (TACC3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
3
AA seq 395 aa AA seqDB search
MAKKLHAGPEATGYSPLSQQVPTASAEDAHEVQTAAGTPGTVGEEGAAERAGASAPAGSL
GGPPQDPEPASDPKEECFRDPTEVLGTGAEVDYLEQFGSSLFKESALRKQSLYLKFDPLL
KDSPRRPVPVAPETNSTQDSTQDMAAPPSGSPTEAKLVELDFLGAPDAPVLDPPPCVFGP
GGPLLPLGSIVDVLQYTQKDMDAAVEAMREENSLLRSRCDTLHAKNLEMGKIMDGFEGIV
YQAMEEAQKQKELAKAEIQKILKEKDQLAADLSSMEKSFSDLFKRFEKQKEVIEGYHTNE
ESLKKCVEDYIVRIEKEGQRYQALKAHAEEKLKLASEEIAQVRSKAQAEALAFQASLRKE
QMRIQSLEKTVEQKTKENEELTRICDDLISKMEKI
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atggccaagaagttgcatgctggtcccgaggccacagggtactcccctctgagccagcag
gtgcctacagcctcggcagaggacgcacatgaggtgcagacggcggcagggaccccaggc
acggtgggtgaggagggagcagcagagcgcgcaggggcatccgctccagcaggcagcctg
ggaggtcctccacaggacccggagccagcctcagaccccaaggaggagtgcttccgagac
cccactgaggtcctaggcacgggagctgaggtggactacctggaacagttcgggagttcc
ttgttcaaggagtcagccctgaggaaacagtccttgtacctcaagtttgacccgctcctg
aaggacagccctcggagaccagtgcctgtggcaccggagaccaacagcacacaggacagc
acacaggacatggccgcacctccctcaggcagcccaaccgaggcgaagctagtggagttg
gatttcctaggagccccagatgctcccgtgctggatccgcctccctgtgtcttcgggcct
ggaggcccgctgctgcccttgggctccatcgtggatgtgctgcagtacacccagaaggac
atggatgcagcggtggaagccatgagagaagagaactccttgctgaggagcaggtgtgac
acactccatgcgaagaatctggaaatggggaagataatggacgggtttgaggggatcgtg
tatcaggcaatggaggaggctcagaaacagaaggaactagcaaaagctgagatccagaag
attctaaaggaaaaagaccagttggctgcagacctgagctccatggaaaagtctttctct
gacctcttcaagcggtttgagaaacagaaggaagtgatcgaggggtatcacacgaatgaa
gaatctctgaagaagtgtgtcgaggattacatagtgaggattgagaaggagggccagcgg
taccaggccctgaaggcccatgcagaagagaagctcaagctggccagtgaggagatcgcc
caggtgcgcagcaaggcccaagcggaggccctggccttccaggccagcctgaggaaggag
cagatgcgcatccagtcactggagaagacagtagagcagaagactaaggaaaatgaagaa
ttaacccgaatctgtgatgacctcatttccaagatggagaagatctga

DBGET integrated database retrieval system