KEGG   Canis familiaris (dog): 479098Help
Entry
479098            CDS       T01007                                 

Gene name
UCHL1, UCHL-1
Definition
ubiquitin carboxyl-terminal esterase L1 (ubiquitin thiolesterase)
Orthology
K05611  
ubiquitin carboxyl-terminal hydrolase L1 [EC:3.4.19.12]
Organism
cfa  Canis familiaris (dog)
Pathway
Parkinson's disease
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Human Diseases
  Neurodegenerative diseases
   05012 Parkinson's disease
    479098 (UCHL1)
Enzymes [BR:cfa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     479098 (UCHL1)
Peptidases [BR:cfa01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   479098 (UCHL1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
3
AA seq 223 aa AA seqDB search
MQLKPMEINPEMLNKVLARLGVAGQWRFADVLGLEDEALGSVPAPACALLLLFPLTAQHE
NFRKKQIEELKGQEVSPKVYFMKQTIGNSCGTIGLIHAVANNQDKLEFEDGSVLKQFLSE
TEKLSPEDRAKCFEKNEAIQAAHDAVAQEGQCRVDDKVNFHFILFNNVDGHLYELDGRMP
FPVNHGTSSEDSLLQDAAKVCREFTEREQGEVRFSAVALCKAA
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgcagctcaagccgatggagatcaaccccgagatgctgaacaaggtgctggcccggctg
ggggtcgccgggcagtggcgcttcgcggacgtgctggggctggaagacgaggctctgggc
tcggtgccggcgcccgcctgcgcgctgctgctgctgtttcccctcacggcccagcatgag
aacttcaggaaaaaacagattgaagaactgaagggacaggaagtcagtcctaaggtgtac
ttcatgaagcagaccattgggaactcctgtggtaccatcgggcttatccatgcagtggcc
aataaccaagacaaactggagtttgaggatgggtcagtcctgaaacagtttctttctgaa
acagagaagctgtcccctgaagaccgagcaaaatgctttgaaaagaatgaggccattcag
gcagcccatgatgccgtggcacaggaaggccaatgtcgggtagatgacaaagtgaatttt
cattttattctgtttaacaacgtggatggccatctctatgaacttgatggacgaatgcct
tttccagtaaaccatggcaccagttcagaggactccttgctgcaggatgccgccaaggtc
tgcagagaattcactgagcgtgagcaaggggaggtccgcttttctgctgtggcactctgc
aaggcagcctaa

DBGET integrated database retrieval system