KEGG   Canis familiaris (dog): 479098Help
Entry
479098            CDS       T01007                                 

Gene name
UCHL1, UCHL-1
Definition
ubiquitin carboxyl-terminal esterase L1 (ubiquitin thiolesterase)
Orthology
K05611  
ubiquitin carboxyl-terminal hydrolase L1 [EC:3.4.19.12]
Organism
cfa  Canis familiaris (dog)
Pathway
Parkinson's disease
Class
Human Diseases; Neurodegenerative diseases; Parkinson's disease [PATH:cfa05012]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
3
AA seq 223 aa AA seqDB search
MQLKPMEINPEMLNKVLARLGVAGQWRFADVLGLEDEALGSVPAPACALLLLFPLTAQHE
NFRKKQIEELKGQEVSPKVYFMKQTIGNSCGTIGLIHAVANNQDKLEFEDGSVLKQFLSE
TEKLSPEDRAKCFEKNEAIQAAHDAVAQEGQCRVDDKVNFHFILFNNVDGHLYELDGRMP
FPVNHGTSSEDSLLQDAAKVCREFTEREQGEVRFSAVALCKAA
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgcagctcaagccgatggagatcaaccccgagatgctgaacaaggtgctggcccggctg
ggggtcgccgggcagtggcgcttcgcggacgtgctggggctggaagacgaggctctgggc
tcggtgccggcgcccgcctgcgcgctgctgctgctgtttcccctcacggcccagcatgag
aacttcaggaaaaaacagattgaagaactgaagggacaggaagtcagtcctaaggtgtac
ttcatgaagcagaccattgggaactcctgtggtaccatcgggcttatccatgcagtggcc
aataaccaagacaaactggagtttgaggatgggtcagtcctgaaacagtttctttctgaa
acagagaagctgtcccctgaagaccgagcaaaatgctttgaaaagaatgaggccattcag
gcagcccatgatgccgtggcacaggaaggccaatgtcgggtagatgacaaagtgaatttt
cattttattctgtttaacaacgtggatggccatctctatgaacttgatggacgaatgcct
tttccagtaaaccatggcaccagttcagaggactccttgctgcaggatgccgccaaggtc
tgcagagaattcactgagcgtgagcaaggggaggtccgcttttctgctgtggcactctgc
aaggcagcctaa

DBGET integrated database retrieval system