KEGG   Canis familiaris (dog): 479156Help
Entry
479156            CDS       T01007                                 

Gene name
CCNH
Definition
cyclin H
Orthology
K06634  
cyclin H
Organism
cfa  Canis familiaris (dog)
Pathway
Basal transcription factors
Nucleotide excision repair
Cell cycle
Module
Holo-TFIIH complex
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    479156 (CCNH)
  Replication and repair
   03420 Nucleotide excision repair
    479156 (CCNH)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    479156 (CCNH)
Transcription machinery [BR:cfa03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     479156 (CCNH)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
3
AA seq 328 aa AA seqDB search
MYHNSSQKRHWTFASEEQLARLRADANRKFKCKAVANGKVLPNDPVFLEPHEEMILCKYY
EKRLLEFCSVFKPAMPRSVVGTACMYFKRFYLNNSVMEYHPRIIMLTCAFLACKVDEFNV
SSPQFVGNLRESPLGQEKALEQILEYELLLIQQLNFHLIVHNPYRPFEGFLIDLKTRYPM
MENPEMLRKTADDFLNRIALTDAYLLYTPSQIALTAILSSASRAGITMESYLSESLMLKE
NRTCLSQLLDIMKSMRNLVKKYEPPRSEEVAALKQKLERCHSAELALNVITKKRKGYEDD
DYVSKKPKHEEVCSPKEEWTDDDLVDSL
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgtaccacaacagcagccagaagcggcactggactttcgcgagcgaggagcagctggcg
cgcctgcgggccgacgccaaccgtaaattcaaatgcaaagcggtggccaacgggaaggtt
cttccaaatgatccagtctttcttgaacctcatgaagaaatgatactctgcaaatactat
gagaagagattattagaattctgttcagtgtttaagccagcaatgccaaggtctgttgtg
ggtacagcttgtatgtatttcaagcgtttttatcttaataactcagtaatggaatatcac
ccccggataataatgcttacttgtgcatttttggcctgcaaagttgatgaattcaacgta
tctagtccacagttcgttggaaatttgagggagagtcctcttggacaagagaaggcactt
gaacagattttggaatatgaactgcttcttatacagcaacttaatttccaccttattgtc
cacaatccttatagaccatttgagggctttctcattgatttaaagactcgctatcccatg
atggagaatcctgagatgttgaggaaaacagctgatgactttcttaatagaatcgcattg
accgacgcttacctgttatatacaccttcccaaattgccctgactgccattttatctagt
gcatctcgagcgggaattactatggaaagttatttatcagaaagtctgatgctgaaagag
aacagaacttgcttatcgcagttactagatataatgaaaagtatgagaaacttggtaaaa
aaatatgagccacccagatctgaagaagttgctgctctgaaacagaagttggagagatgt
cactctgctgagcttgcccttaacgtaattacgaagaagaggaaaggctatgaagatgat
gattatgtctcaaagaaacccaaacatgaagaggtatgttctccaaaggaagaatggact
gacgatgacctcgtagattctctctag

DBGET integrated database retrieval system