KEGG   Canis familiaris (dog): 479156Help
Entry
479156            CDS       T01007                                 

Gene name
CCNH
Definition
(RefSeq) cyclin H
  KO
K06634  cyclin H
Organism
cfa  Canis familiaris (dog)
Pathway
cfa03022  Basal transcription factors
cfa03420  Nucleotide excision repair
cfa04110  Cell cycle
Module
cfa_M00290  Holo-TFIIH complex
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    479156 (CCNH)
  Replication and repair
   03420 Nucleotide excision repair
    479156 (CCNH)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    479156 (CCNH)
Transcription machinery [BR:cfa03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     479156 (CCNH)
DNA repair and recombination proteins [BR:cfa03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TFIIH complex
     479156 (CCNH)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cyclin_C_2 Cyclin_N Cyclin_C
Motif
Other DBs
NCBI-GeneID: 479156
NCBI-ProteinID: XP_005618199
Ensembl: ENSCAFG00000008374
Position
3
AA seq 328 aa AA seqDB search
MYHNSSQKRHWTFASEEQLARLRADANRKFKCKAVANGKVLPNDPVFLEPHEEMILCKYY
EKRLLEFCSVFKPAMPRSVVGTACMYFKRFYLNNSVMEYHPRIIMLTCAFLACKVDEFNV
SSPQFVGNLRESPLGQEKALEQILEYELLLIQQLNFHLIVHNPYRPFEGFLIDLKTRYPM
MENPEMLRKTADDFLNRIALTDAYLLYTPSQIALTAILSSASRAGITMESYLSESLMLKE
NRTCLSQLLDIMKSMRNLVKKYEPPRSEEVAALKQKLERCHSAELALNVITKKRKGYEDD
DYVSKKPKHEEVCSPKEEWTDDDLVDSL
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgtaccacaacagcagccagaagcggcactggactttcgcgagcgaggagcagctggcg
cgcctgcgggccgacgccaaccgtaaattcaaatgcaaagcggtggccaacgggaaggtt
cttccaaatgatccagtctttcttgaacctcatgaagaaatgatactctgcaaatactat
gagaagagattattagaattctgttcagtgtttaagccagcaatgccaaggtctgttgtg
ggtacagcttgtatgtatttcaagcgtttttatcttaataactcagtaatggaatatcac
ccccggataataatgcttacttgtgcatttttggcctgcaaagttgatgaattcaacgta
tctagtccacagttcgttggaaatttgagggagagtcctcttggacaagagaaggcactt
gaacagattttggaatatgaactgcttcttatacagcaacttaatttccaccttattgtc
cacaatccttatagaccatttgagggctttctcattgatttaaagactcgctatcccatg
atggagaatcctgagatgttgaggaaaacagctgatgactttcttaatagaatcgcattg
accgacgcttacctgttatatacaccttcccaaattgccctgactgccattttatctagt
gcatctcgagcgggaattactatggaaagttatttatcagaaagtctgatgctgaaagag
aacagaacttgcttatcgcagttactagatataatgaaaagtatgagaaacttggtaaaa
aaatatgagccacccagatctgaagaagttgctgctctgaaacagaagttggagagatgt
cactctgctgagcttgcccttaacgtaattacgaagaagaggaaaggctatgaagatgat
gattatgtctcaaagaaacccaaacatgaagaggtatgttctccaaaggaagaatggact
gacgatgacctcgtagattctctctag

DBGET integrated database retrieval system