KEGG   Canis familiaris (dog): 479254Help
Entry
479254            CDS       T01007                                 

Gene name
KAT6B, MYST4
Definition
K(lysine) acetyltransferase 6B
Orthology
K11306  
histone acetyltransferase MYST4 [EC:2.3.1.48]
Organism
cfa  Canis familiaris (dog)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
4
AA seq 1907 aa AA seqDB search
MVKLANPLYTEWILEAIQKIKKQKQRPSEERICHAVSTSHGLDKKTVSEQLELSVQDGSV
LKVTNKGLASYKDPDNPGRFSSVKPGTFPKSTKGSRGSCNDLRNVDWNKLLRRAIEGLEE
PNGSSLKNIEKYLRSQSDLTSTTNNPAFQQRLRLGAKRAVNNGRLLKDGPQYRVNYGSLD
GKGAPKYPSAFPSSLPPVSLLPHEKDQPRADPIPICSFCLGTKESNREKKPEELLSCADC
GSSGHPSCLKFCPELTTNVKALRWQCIECKTCSACRIQGKNADNMLFCDSCDRGFHMECC
DPPLSRMPKGMWICQVCRPKKKGRKLLHEKAAQIKRRYAKPIGRPKNKLKQRLLSVTSDE
GSMNAFTGRGSPGRGQKTKVCTTPSSGHAASGKDSSSRLAVTDPTRPGATTKITTTSTYI
SASTLKVNKKTKGLIDGLTKFFTPSPDGRRSRGEIIDFSKHYRPRKKVSQKQSCTSHVLA
TDTEIKISIKQESTDINVIGNKDTVTEEDLDVFKQAQELSWEKIECESGVEDCGRYPSVI
EFGKYEIQTWYSSPYPQEYARLPKLYLCEFCLKYMKSKNILLRHSKKCGWFHPPANEIYR
RRDLSVFEVDGNMSKIYCQNLCLLAKLFLDHKTLYYDVEPFLFYVLTKNDEKGCHLVGYF
SKEKLCQQKYNVSCIMIMPQHQRQGFGRFLIDFSYLLSRREGQAGSPEKPLSDLGRLSYL
AYWKSVILEYLYHHQERHISIKAISRATGMCPHDIATTLQHLHMIDKRDGRFVIIRREKL
ILGHMEKLKTCSRTNELDPESLRWTPILISNAAVSEEEREAEKEAERLMEQASCWEKEEQ
EILSSRANSRQSPAKVQSKNKYLHSPESRPVAGERGQLMELSKESSEEEEEEEEEEEEEE
EEEEEEEEEEEEEEEEEEEEEEEEEEEEVEEEEEEEENIQSSPPRLTKPQSVAIKRKRPF
VLKKKRGRKRRRINSSVTTETISETTEVLNEPFDNSDEERPMPHLEPTCEIEVEEDGGKP
VLRKTFQHQPGKKKQTEEEEEKDNHCFKNADPCRNNMDDDTDTLKEGSRDNPEPLKCKQV
WPKGTKRGLSKWRPNKERKTGFKLNLYTPPETPMEPDDQITVEEQKETPEDKSSPTPTRI
EEEVKEAMEPLLPRDENRRDETCAPISPNKSPGEKTEDDAIKPEEEEEEEEEEDDEEEEE
EEEEEEEEEEENVAKDPGGAKSQEKEEPEVCLGKEDSVALDDHEEEEEEDEEPSHNEGHD
ADDEDDSHMEGAQAEKEDRPREAFKEVLENQEAFLDLSVQPSHSNSEVLMDCGVDLAAAC
NGEPKELAGGTDAAPESDEESPEEQAPKQDQKSSEGVDSEFKERNTTTVEIDSETVQAVQ
SLTQENSEQDDTFQDCTETQEACRSLQNYTHADQSPQIATTLDDCQQSDHSSPVSSVHSH
PSQSVRSVNSPSVPALENSYAQISPDQSAISVPSLQNMETSPMMDVPSVSDHSQQVVDSG
FSDLGSIESTTENYENPSSYDSTMGGSICGNGSSQNSCSYSNLTSSNLTQSSCAVTQQMS
NISGSCSMLQQTSISSPPTCSVKSPQGCVVERPPSSSQQLAQCSMAANFTPPMQLPEIPE
TGNANIGLYERMGQSDFGAGHYPQPSATFSLAKLQQLTNTLIDHSLPYSHSAAVTSYANS
ASLSTPLSNTGLVQLSQSPHSVPGGPQAQATMTPPPNLTPPPMNLPPPLLQRNMAASNIG
ISHSQRLQTQIASKGHVSMRTKSASLSPAAATHQSQIYGRSQTVAMQGPARTLTMQRGMN
MSVNLMPAPAYNVNSVNMNMNTLNAMNGYSMSQPMMNSGYHSNHGYMNQTPQYPMQMQMG
MMGTQPYAQQPMQTPPHGNMMYTAPGHHGYMNTGMSKQSLNGSYMRR
NT seq 5724 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaacttgcaaacccactttatacagagtggattcttgaagctatacagaagata
aaaaagcaaaagcaaagaccctctgaagagagaatttgccatgcagtcagcacttcccac
gggttggataagaagacagtctctgagcagctggaactcagtgttcaggatggctcagtt
ctcaaagtcaccaacaaaggccttgcctcctataaggacccagacaaccctgggcgtttt
tcatcagttaaaccaggcacttttcctaagtcaaccaagggatctaggggatcatgcaat
gatctccggaatgtggattggaataaacttttaaggagagcaattgaaggacttgaggag
ccaaatggctcctccctgaagaacatcgagaagtatctcagaagtcaaagtgatctcaca
agcaccaccaacaacccagcctttcagcagcggctgcgactaggagccaaacgtgcagtg
aacaacgggaggttactgaaagatggaccgcagtacagggtcaattatgggagcttagat
ggcaaaggggctcccaaatatcccagtgctttcccatcctcgctaccacctgtcagcctt
ctaccccatgagaaagaccagccccgtgctgatcccattccgatatgtagcttctgtttg
gggactaaggaatcaaatcgtgaaaagaaaccagaagaactcctctcttgtgcagattgt
ggcagtagcggacacccatcctgtctgaaattttgtcctgaattaacaacaaatgtaaag
gccttaaggtggcagtgcatcgaatgcaagacctgcagtgcatgtagaatccaaggcaaa
aatgcagataatatgcttttttgtgactcctgtgacagaggattccatatggagtgctgt
gaccccccactttccagaatgccaaaagggatgtggatttgccaagtctgcagaccaaag
aaaaagggaagaaaactacttcatgagaaagctgcacaaataaaacgacgatatgcaaaa
cccattggacgaccgaaaaataaattaaagcaacgattgttgtctgtaaccagtgatgaa
ggatccatgaatgcattcacaggaagggggtcacctggtaggggtcaaaagactaaagtc
tgtaccacaccttcatctggtcatgctgcatctgggaaggactcaagcagcagattggct
gttacagaccccactcggcctggtgccaccaccaaaatcaccaccacctccacctacatt
tctgcctctacacttaaagttaacaagaaaaccaaagggctcattgatggccttactaag
ttttttacaccatcacctgatggtcgcagatcacgaggtgaaataatagacttttcaaag
cactatcgtccaaggaaaaaggtctctcagaaacagtcatgcacttctcatgtgttggct
acagatactgaaatcaaaataagcatcaaacaagaaagtacagatataaatgtgattgga
aacaaggataccgttacagaagaggatttggatgtttttaagcaggcccaggaactttct
tgggagaaaatagagtgtgaaagtggagtggaagactgtggccggtacccttctgtaata
gaattcgggaaatacgaaatccaaacctggtattcctcgccttacccacaggaatatgca
agattaccaaagctttacctgtgtgaattctgtcttaaatatatgaaaagtaaaaatatt
ttattaagacactcaaagaaatgtggatggtttcatcctccagcaaatgaaatttaccga
aggagagacctttcagtatttgaggttgatgggaatatgagcaaaatttattgccaaaac
ctttgcttgttagccaagctcttcctggaccacaaaacgttgtattatgatgtcgagcca
ttccttttttatgtccttacaaaaaatgatgaaaagggctgtcatctggttggatacttc
tctaaggaaaagctttgccagcagaagtataatgtctcctgcataatgatcatgccccag
caccaaaggcaaggatttggacggtttctcattgatttcagctatttgctttctagaaga
gaaggccaggcagggtctcctgaaaagccactctctgatctgggccgcctctcctacctg
gcctactggaagagcgtcatcttagaatatctctaccaccaccaggagaggcacatcagc
atcaaagccatcagcagagctacgggcatgtgcccacatgacattgccactactctgcag
cacctccatatgattgacaaaagggatggcagatttgtcatcattagaagggaaaagttg
atattgggccacatggaaaagctgaaaacctgttcccggaccaatgaacttgatccagaa
agcctaaggtggaccccaattttaatttctaatgctgcagtttctgaagaagagcgagaa
gctgagaaagaggctgagcgcttaatggaacaagctagctgctgggaaaaggaggagcaa
gaaatcctgtcctctagagcgaacagtaggcaatcacctgcaaaagtacaatcgaaaaat
aaatatttgcattccccggagagccggccagtggcaggggagcgagggcagctgatggag
ctgtctaaggagagcagtgaagaagaggaggaagaggaggaggaagaggaagaagaagag
gaggaggaagaggaagaagaggaagaagaagaagaagaagaagaagaagaagaagaagaa
gaagaagaagaagaagaagaagaagtagaagaagaagaagaagaagaagaaaatattcag
agttctcctccgagattgactaaaccacaatcagttgccataaagagaaagaggcctttt
gtgctaaagaagaaaaggggccgtaaacgcaggaggatcaacagcagtgtaacaactgag
accatttctgagacgacagaagtactgaatgagccctttgacaactcagatgaagagagg
ccaatgccacacctggagcctacctgtgagattgaagtggaggaagatggcgggaagcca
gtcctgagaaaaacattccaacatcagcctgggaagaaaaaacaaacagaggaagaggaa
gaaaaagacaatcattgttttaagaatgctgacccttgtagaaacaatatggatgatgat
acagataccttgaaagaaggcagcagagacaatcctgaacctctaaagtgcaaacaagta
tggccaaaaggaacaaaacgtggtctatctaagtggaggccgaacaaagaaaggaagacc
ggatttaaactgaacctgtacaccccgccagaaacacccatggaacctgatgaccagata
acagtagaagaacagaaggagactccagaagacaaaagcagccccactcccaccaggatt
gaggaggaggtcaaggaagctatggaacccctgctgcctcgggatgaaaacagaagggac
gaaacgtgtgcacctataagtccgaataaatcgccaggtgaaaaaacagaagatgatgca
atcaagcctgaggaggaagaagaagaggaggaggaagaagatgacgaagaggaagaggaa
gaagaggaagaagaagaagaagaagaagaagaaaatgtcgcaaaggacccaggtggtgct
aaaagtcaagaaaaagaagaaccagaagtctgcctgggcaaagaagactctgttgccctg
gacgatcatgaagaggaggaggaagaggatgaagagccgtctcacaatgagggtcatgat
gcagatgatgaagatgatagtcacatggagggtgcgcaagcagagaaggaagaccggcca
agagaagccttcaaagaagtactggagaaccaggaggcttttttagaccttagtgtccag
cctagccattcgaactcagaggtcttaatggactgtggcgttgaccttgcagctgcttgt
aacggtgagcccaaggagcttgctggaggcactgacgctgcgcctgaatcggacgaggaa
tcaccggaagaacaggcaccgaagcaggaccaaaagagcagcgaaggcgtggattccgag
ttcaaagagagaaataccacaaccgtggaaatagactctgagaccgttcaggcggttcag
tctttgacccaggagaacagtgagcaggacgacacgtttcaggattgcaccgagacccaa
gaggcctgtaggagcctccagaactacacccatgcagaccaaagtccacagatcgccacc
actctggacgactgccagcagtcagaccacagtagcccagtttcgtccgtccactcccat
cccagccagtcagtacgttctgtcaacagccccagcgtccctgccctggaaaacagctat
gcccaaatcagcccagatcaaagtgccatctccgtgccatctctgcagaacatggaaacc
agtcccatgatggacgtcccgtcggtgtccgatcattcacagcaagttgtggacagcgga
ttcagtgacctgggcagcatcgagagcacaactgaaaactatgaaaacccgagtagctat
gactctaccatgggcggcagcatttgtggaaacggttcctcccagaacagctgctcctat
agcaacctcacctcgagcaatctgacacagagcagctgtgctgtcacccagcagatgtcc
aacatcagtgggagctgcagcatgctgcagcagaccagcatcagctctcccccgacctgc
agcgtcaagtctccccaaggctgtgtggtggagaggcctcccagcagcagccagcagctg
gcccagtgcagcatggctgctaatttcaccccgcccatgcagctgcctgagatccccgag
actggcaacgccaacatcggcctgtatgaacggatgggccagagtgattttggggctggg
cactacccgcagccatcagccaccttcagccttgccaaactacagcagttaactaataca
ctgattgatcattcattgccttacagccattccgctgctgtaacttcctatgcaaacagt
gcctctttgtccacaccactaagtaacacagggcttgttcagctttcccagtctccgcac
tccgtccctgggggaccccaagcacaagctacgatgaccccgccccccaacctgactcct
cctccgatgaatctgccaccgcctcttctgcaacggaacatggctgcgtcaaatattggc
atctcccacagccaaagactgcaaacccagattgccagcaagggccacgtctccatgaga
accaaatcggcatctctgtcaccagccgccgccacccatcagtcgcaaatctatgggcgc
tcccagactgtagccatgcagggtcctgcacggactttaacgatgcagagaggcatgaac
atgagtgtgaacctgatgccagccccagcctacaacgtcaactctgtgaacatgaacatg
aatactctcaatgccatgaatgggtacagcatgtcccagccgatgatgaacagtggctac
cacagcaatcatggctacatgaatcaaacaccccaataccctatgcagatgcagatgggc
atgatgggaacccagccatatgcccagcagccaatgcagaccccaccccacggtaacatg
atgtacacggcccctggacatcacggctacatgaacacgggcatgtccaaacagtctctc
aatgggtcctacatgagaaggtag

DBGET integrated database retrieval system