KEGG   Canis familiaris (dog): 479351Help
Entry
479351            CDS       T01007                                 

Gene name
PRKAA1
Definition
(RefSeq) protein kinase AMP-activated catalytic subunit alpha 1
  KO
K07198  5'-AMP-activated protein kinase, catalytic alpha subunit [EC:2.7.11.11]
Organism
cfa  Canis familiaris (dog)
Pathway
cfa04068  FoxO signaling pathway
cfa04140  Autophagy - animal
cfa04150  mTOR signaling pathway
cfa04151  PI3K-Akt signaling pathway
cfa04152  AMPK signaling pathway
cfa04211  Longevity regulating pathway
cfa04213  Longevity regulating pathway - multiple species
cfa04371  Apelin signaling pathway
cfa04530  Tight junction
cfa04710  Circadian rhythm
cfa04714  Thermogenesis
cfa04910  Insulin signaling pathway
cfa04920  Adipocytokine signaling pathway
cfa04921  Oxytocin signaling pathway
cfa04922  Glucagon signaling pathway
cfa04931  Insulin resistance
cfa04932  Non-alcoholic fatty liver disease (NAFLD)
cfa05410  Hypertrophic cardiomyopathy (HCM)
cfa05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Environmental Information Processing
  Signal transduction
   04371 Apelin signaling pathway
    479351 (PRKAA1)
   04068 FoxO signaling pathway
    479351 (PRKAA1)
   04151 PI3K-Akt signaling pathway
    479351 (PRKAA1)
   04152 AMPK signaling pathway
    479351 (PRKAA1)
   04150 mTOR signaling pathway
    479351 (PRKAA1)
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    479351 (PRKAA1)
  Cellular community - eukaryotes
   04530 Tight junction
    479351 (PRKAA1)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    479351 (PRKAA1)
   04922 Glucagon signaling pathway
    479351 (PRKAA1)
   04920 Adipocytokine signaling pathway
    479351 (PRKAA1)
   04921 Oxytocin signaling pathway
    479351 (PRKAA1)
  Aging
   04211 Longevity regulating pathway - mammal
    479351 (PRKAA1)
   04213 Longevity regulating pathway - multiple species
    479351 (PRKAA1)
  Environmental adaptation
   04710 Circadian rhythm
    479351 (PRKAA1)
   04714 Thermogenesis
    479351 (PRKAA1)
 Human Diseases
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    479351 (PRKAA1)
   05410 Hypertrophic cardiomyopathy (HCM)
    479351 (PRKAA1)
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    479351 (PRKAA1)
   04931 Insulin resistance
    479351 (PRKAA1)
Enzymes [BR:cfa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     479351 (PRKAA1)
Protein kinases [BR:cfa01001]
 Serine/threonine kinases: CAMK group
  CAMKL family
   479351 (PRKAA1)
Membrane trafficking [BR:cfa04131]
 Autophagy
  Other autophagy associated proteins
   Others
    479351 (PRKAA1)
Mitochondrial biogenesis [BR:cfa03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    479351 (PRKAA1)
  Mitophagy factors
   Other mitophagy factors
    479351 (PRKAA1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr AdenylateSensor Kinase-like FTA2 Kdo APH
Motif
Other DBs
NCBI-GeneID: 479351
NCBI-ProteinID: XP_536491
Ensembl: ENSCAFG00000018614
Position
4
AA seq 587 aa AA seqDB search
MAPLAAPGVVRVSVPSRRFSPYLPGPILSVRWVPPPQPPPEMFLNYQFCRLCAKLVGKHE
LTGHKVAVKILNRQKIRSLDVVGKIRREIQNLKLFRHPHIIKLYQVISTPSDIFMVMEYV
SGGELFDYICKNGRKSDVPGVVRTGFMKELDEKESRRLFQQILSGVDYCHRHMVVHRDLK
PENVLLDAHMNAKIADFGLSNMMSDGEFLRTSCGSPNYAAPEVISGRLYAGPEVDIWSSG
VILYALLCGTLPFDDDHVPTLFKKICDGIFYTPQYLNPSVISLLKHMLQVDPMKRATIKD
IREHEWFKQDLPKYLFPEDPSYSSTMIDDEALKEVCEKFECSEEEVLSCLYNRNHQDPLA
VAYHLIIDNRRIMNEAKDFYLATSPPDSFLDDHHLTRPHPERVPFLVAETPRARHTLDEL
NPQKSKHQGVRKAKWHLGIRSQSRPNDIMAEVCRAIKQLDYEWKVVNPYYLRVRRKNPVT
STYSKMSLQLYQVDSRTYLLDFRSIDDEITEAKSGTATPQRSGSVSNYRSCQRNDSDAEA
QGKSSEASLTSSVTSLDSSPVDLTPRPGSHTIEFFEMCANLIKILAQ
NT seq 1764 nt NT seq  +upstreamnt  +downstreamnt
atggcccccctggcggcgcccggggtcgtccgcgtttccgtcccctctaggaggttctcc
ccttacctgccggggccgattcttagtgtgcgatgggtgccccctcctcagcctccccca
gaaatgtttctgaattaccagttttgcagactctgtgccaaacttgttggcaaacatgaa
ttgactgggcataaagttgctgtgaagatactcaatcgacagaagattcgaagccttgat
gtggtaggaaaaatccgcagagaaattcagaacctcaagcttttcaggcatcctcatata
attaaactgtaccaggtcatcagtacaccatctgatattttcatggtgatggaatatgtc
tcaggaggagagctatttgattatatctgtaaaaatggaaggaaatctgatgtacctgga
gtagtaagaacaggcttcatgaaggagctggatgaaaaagaaagtcggcgtctgtttcaa
cagatcctttctggtgtggattactgtcacaggcatatggtggtccatagagatttgaaa
cctgaaaatgtcttgcttgatgcacacatgaatgcaaagatagctgattttggtctttca
aacatgatgtcagatggtgaatttttaagaacaagttgtggctcacccaactatgctgca
ccagaagtaatttcaggaagattgtatgcaggtccagaggtagatatatggagcagtggg
gttattctctatgctttattatgtggaacccttccatttgatgatgatcatgtgccaact
ctttttaagaagatatgtgatgggatcttttatacccctcagtatttaaatccatctgtg
attagccttttgaaacatatgctccaggtggatcccatgaagagggccacaatcaaagat
atcagggaacatgaatggtttaaacaagaccttccaaaatacctttttcccgaggatcca
tcgtatagttcaactatgattgatgatgaagccttaaaagaagtatgtgaaaaatttgag
tgctcagaagaggaagttctcagctgcctttataacagaaatcaccaggaccctttagca
gttgcctaccaccttataatagataacaggagaataatgaatgaggccaaagatttttac
ttggcaacaagcccacctgattcttttctcgatgatcaccatttgactcggccccatcct
gaaagagtaccattcttggttgctgaaacacctagggcacgccacactctcgatgaatta
aatccacagaaatctaagcaccaaggtgtaaggaaagcaaaatggcatttgggaattaga
agtcaaagtcgaccaaatgatatcatggcagaagtttgtagggcaattaaacaactggat
tatgaatggaaggttgtaaacccttattatttgcgtgttcgaaggaagaatcctgtgaca
agcacctactccaaaatgagtctacagttataccaagtggatagtagaacgtacttactg
gatttccgtagtatcgatgatgaaattactgaagccaaatcagggactgctactccacag
agatcgggatcagttagcaactatcgatcttgccaaaggaatgattcagatgctgaggct
caaggaaaatcctcagaagcttctcttacctcatctgtgacctcacttgactcttctcct
gttgatttaactccaagacctggaagtcacacaatagaattttttgagatgtgtgcaaat
ctaattaaaattcttgcacagtaa

DBGET integrated database retrieval system