KEGG   Canis familiaris (dog): 479363Help
Entry
479363            CDS       T01007                                 

Gene name
PRLR
Definition
prolactin receptor
Orthology
K05081  
prolactin receptor
Organism
cfa  Canis familiaris (dog)
Pathway
Cytokine-cytokine receptor interaction
Neuroactive ligand-receptor interaction
PI3K-Akt signaling pathway
Jak-STAT signaling pathway
Prolactin signaling pathway
Class
Environmental Information Processing; Signal transduction; Jak-STAT signaling pathway [PATH:cfa04630]
Environmental Information Processing; Signal transduction; PI3K-Akt signaling pathway [PATH:cfa04151]
Environmental Information Processing; Signaling molecules and interaction; Neuroactive ligand-receptor interaction [PATH:cfa04080]
Environmental Information Processing; Signaling molecules and interaction; Cytokine-cytokine receptor interaction [PATH:cfa04060]
Organismal Systems; Endocrine system; Prolactin signaling pathway [PATH:cfa04917]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 625 aa AA seqDB search
MKESVASRTVFILLLFLTTSLLNGQSPPGKPEILKCRSPEKETFTCWWKPGDDGGLPTNY
TLTYHKEGETLTHECPDYITSGPNSCYFNKKHTSIWTMYIITINATNQMGSSSSDPRYVD
VTYIVEPDPPVNLTLELKQPEDKKPYLWMKWYPPTLVDVRSGWLTLQYEIRLKPKKATEW
ETHFAGQQTQFKILSLYPGQKYLVQVRCKPDHGFWSEWSPESSIQIPNDVTMKDTIVWIF
VAVLSAVICLIMVVAVALKGHSMVTCILPPVPGPKIKGFDTHLLEKGKSEELLSALGCQD
FPPTSDCEDLLVEFLEVDDSEDQQLMPAHPKEHPGQERKPTPLDPDSDSGRGSCDSPSLL
SKKCEEARADPSAFNTPKSVEKPENPQTNVTYTWGSRSTSSEGKIPYFAAGGFKSSTWPL
PQPPSQHSPRSSYHNIADVCKLNMGTAGASATLLDKTDTRALRSSKTTETGGEEKAAEQR
EVESFHSKTDQDTPWLLPQEKTPLISVRPLDYVEIHKVNKDGALSLLPKQKENSGQAEKP
STPEASKEYAKVSRVMDNNILVLVQEPRAQNLASFEEPAKEAAPSHQQNQAEEDLASFTS
APSGCGLQRAGLDYLDPTCFMHSFQ
NT seq 1878 nt NT seq  +upstreamnt  +downstreamnt
atgaaggaaagtgtggcatccagaactgttttcattttgctactttttctcaccaccagt
ctcctgaatggacaatcacctcctggaaaacctgagatccttaaatgtcgttctcctgag
aaggagacattcacctgctggtggaagcctggagatgatggaggacttcccactaattac
acattgacttaccacaaggaaggagagacactcacacatgaatgcccagactacataacc
agtggccccaactcctgttacttcaacaagaagcacacatccatatggacaatgtacatc
atcacaataaatgccacaaaccagatgggaagcagttcctcggatccacgttatgtcgac
gtgacttacatagttgaaccagaccctcctgtgaacctaactttggaactaaaacaacca
gaagacaaaaagccttatctgtggatgaaatggtacccacccaccctggttgatgttaga
tctggttggctcacactccagtatgaaattcggttaaaacccaagaaagcaactgagtgg
gagactcattttgctgggcagcagactcagtttaagattctcagcttatatccaggacag
aaataccttgtccaggttcgctgcaagccagaccatggattctggagtgagtggagccca
gagagctccattcagatacctaatgatgtcaccatgaaagataccatcgtgtggatcttt
gtggccgttctttctgctgtcatctgtctgattatggtcgtagcagtggctttgaaaggc
catagcatggtgacctgcatccttccaccagttcctgggccaaaaataaaaggatttgat
actcatctgctggagaagggtaaatctgaagaactactgagcgcactggggtgccaagac
ttccctcccacttctgactgtgaggacttgctggtggagtttttagaagtggatgacagt
gaggaccagcagctgatgccagcgcatccaaaagaacatccagggcaagagaggaagccc
acccccttggatccagacagcgactctggccggggcagctgcgacagcccttcccttctg
tctaaaaagtgtgaggaagctcgggcagatccctccgcatttaacactcccaagagcgtt
gagaagccagagaaccctcaaacaaatgtgacctacacttggggctcccggagcacaagc
tcggaaggcaaaatcccctacttcgctgccggcgggttcaaatcttcaacatggcctttg
ccacagccccccagccagcacagccccaggtcttcttaccacaacattgctgatgtgtgt
aagctgaacatgggcacggcaggtgcatcagccactctgctggacaaaacagacacacgt
gctttgagatcttcaaaaaccactgagactggaggggaggaaaaggcagctgagcagagg
gaagtggaaagcttccattccaagactgaccaagacacaccatggctgttgccccaggag
aaaacccctttgatctctgttaggcccttggattacgtggagattcacaaggtcaacaaa
gatggagcattgtcgttgctcccaaaacagaaagagaacagcggccaggcagagaagccc
agcactcccgaagccagtaaggagtatgctaaggtgtccagggtgatggataacaacatc
ctggtgttagtgcaggagccgcgagctcaaaacctggcttcgtttgaagaaccagccaag
gaggctgcgccgtcccatcaacagaatcaagctgaagaagacctggcctccttcacctcg
gcaccaagtggctgtggactccagcgggctgggttggattacctggatcccacgtgtttt
atgcactcctttcagtga

DBGET integrated database retrieval system