KEGG   Canis familiaris (dog): 479476Help
Entry
479476            CDS       T01007                                 

Gene name
ALOX12
Definition
(RefSeq) arachidonate 12-lipoxygenase, 12S-type
  KO
K00458  arachidonate 12-lipoxygenase [EC:1.13.11.31]
Organism
cfa  Canis familiaris (dog)
Pathway
cfa00590  Arachidonic acid metabolism
cfa01100  Metabolic pathways
cfa01523  Antifolate resistance
cfa04726  Serotonergic synapse
cfa04750  Inflammatory mediator regulation of TRP channels
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    479476 (ALOX12)
 Organismal Systems
  Nervous system
   04726 Serotonergic synapse
    479476 (ALOX12)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    479476 (ALOX12)
 Human Diseases
  Drug resistance
   01523 Antifolate resistance
    479476 (ALOX12)
Enzymes [BR:cfa01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.31  arachidonate 12-lipoxygenase
     479476 (ALOX12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Lipoxygenase PLAT
Motif
Other DBs
NCBI-GeneID: 479476
NCBI-ProteinID: XP_013968984
Ensembl: ENSCAFG00000023006
Position
5
AA seq 622 aa AA seqDB search
MGRYCVRVTTGAWLFSGSHNRVQLWLVGARGDAELELQLRPARGQEEEFDLDIPKDLGPL
QFVKLCKHHSLVDDAWFCDLITVRGPGASEEAAFPCYQWVQGQGVLSLPEGTARLAGDNA
LDVFQKHREKELKERQKLYWALEMVLKRIYTLLSSWNHLEDFDQIFWGQKSILAEKVHQC
WQDDELFGYQFLNGANPMLLRRSACLPSRLVLPPGMEALRAQLERELQNGSLFEADFILL
DGLPTNVIRGEKQYLAAPLVLLKMEPNGKLLPMLIQIQPPGPSSPTSPLFLPSDPPLAWL
LAKVWVRNSDFQLHQLQYHLLNTHLVAEVMAVATMRCLPGLHPVFKLLIPHIRYTMEINT
RARTQLISEGGIFDKVVSTGGGGHVQLLRRAMAQLTYRSLCPPDDLADRGLLGIPSALYA
HDALRLWGIIAQYVEGIVHLFYHRDDVVRGDSELQAWCREITEVGLCHAQERGFPISFQS
RKQLCHFLTMCIFTCTAQHGAINQGQLDWYAWVPNAPCTMRMPPPTTKEEVKMATVMGSL
PDVRQACLQMTITWHLGRRQPDMVPLGHHKEKYFSSPKAKAVLNQFQTDLENLEREITAR
NEQLDLPYDYLKPSRIENSVTI
NT seq 1869 nt NT seq  +upstreamnt  +downstreamnt
atgggccgctactgcgtccgcgtgaccaccggggcttggctcttctcaggctcgcataac
cgcgtgcagctctggctggtcggggcgcgcggggacgcggagctggagctgcagctgcgg
ccggcgcggggtcaggaggaggagtttgatctcgacattcccaaggacctggggcccctg
cagttcgtgaagttgtgcaaacaccactccctggtggacgacgcctggttctgcgacctc
atcacggtgcggggcccgggagcctccgaggaggccgccttcccctgctaccaatgggtg
cagggccagggcgtgctgagcctgccggagggcaccgcacgcctggcaggagataatgca
ctggatgtgttccagaagcatcgagagaaagaactgaaggaaagacaaaagctgtactgg
gcgctggagatggtcctcaaacgcatctacactctcctgagctcctggaaccacctggag
gattttgatcagatcttctggggccagaagagcattctggctgagaaggttcaccagtgc
tggcaggatgatgagctttttggctaccagttcctcaatggcgccaaccccatgctgttg
agacgctctgcctgcctgccctcccgtctagtgctgcccccagggatggaggcacttcgg
gcccagctggagagagagctccagaatggttctctgttcgaggctgacttcatcctcctg
gatggacttccaaccaatgtgatccggggagagaagcagtacctggctgcccccctcgtc
ctgctgaagatggaacccaatgggaagctgctgcccatgcttatccagatccagcctccc
ggccccagctcccccacctcgccgctgttcctgccctcagaccccccacttgcctggctc
ctggcaaaggtctgggtccgaaattcagatttccaactgcaccagctccagtatcacctg
ctaaacactcatctggtggccgaggtcatggctgtggccaccatgaggtgcctcccgggg
ctgcaccctgtcttcaagctcctgatcccgcatatccgctacaccatggagatcaacacg
cgggccagaacccagctcatctcagaagggggaatattcgataaggtggtgagcacgggt
ggagggggccatgtgcagctgctccgtcgggccatggctcagctgacctaccgttccctc
tgtcctcctgatgacctggctgaccggggcctgctggggatcccaagtgccctctatgcc
cacgatgctctacggctctgggggatcattgcccagtacgtggagggcattgtccacctc
ttctaccaccgggatgacgtcgtgagaggggactctgagctgcaggcctggtgtcgggag
atcactgaggtggggctgtgccacgcccaggagcgaggtttccccatctccttccagtcc
cggaagcaactgtgccacttccttaccatgtgcatcttcacatgcactgctcagcacggg
gccatcaaccagggccagctggactggtatgcctgggtccctaatgccccatgcacaatg
cggatgcccccacctaccaccaaggaagaggtgaaaatggctacagtgatgggctcacta
cctgatgtccgacaggcttgtcttcaaatgaccatcacgtggcatctgggtcgccgccag
ccagacatggtgcctctgggacatcacaaagaaaagtatttctcaagccccaaggccaag
gctgtattaaaccaattccaaacagatttggaaaacctagaaagagagattacagcccgg
aatgagcagctcgacctgccctatgattacctgaaacccagccgcatagagaatagtgtc
actatctga

DBGET integrated database retrieval system