KEGG   Canis familiaris (dog): 479549Help
Entry
479549            CDS       T01007                                 

Gene name
USP1
Definition
ubiquitin specific peptidase 1
Orthology
K11832  
ubiquitin carboxyl-terminal hydrolase 1 [EC:3.1.2.15]
Organism
cfa  Canis familiaris (dog)
Pathway
Fanconi anemia pathway
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Genetic Information Processing
  Replication and repair
   03460 Fanconi anemia pathway
    479549 (USP1)
Enzymes [BR:cfa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     479549 (USP1)
Peptidases [BR:cfa01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   479549 (USP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
5
AA seq 785 aa AA seqDB search
MPGVIPSESNGLSRGSPSKKNRLSLKFFQKKETKRALDFTDSQENEEKASEYRGSEIDQV
VPAAQSSPVHCEKRENLLPFVGLNNLGNTCYLNSILQVLYFCPGFKSGVKHLFNIISRKK
EALKDEANQKDKGSCKEDSLASYELICSLQSLIISVEQLQASFLLNPEKYTDELATQPRR
LLNTLRELNPMYEGYLQHDAQEVLQCILGNIQETCQLLKKEEVKNVVELSTKIEEKPHQK
EEMSGINSIEMDNLRPSEDYKEKLPKGNGKRKSDTEFGNMKKKVKVSKEHQSLEENQRQT
RSKRKATGDTLEIPSKIIPKCVSENESARPSQKKSRVKINWLKPATKQPSILSKFCSLGK
ITTNQGSKEQLKENEYDLEEDLGKCENDNTTNGCELESPGDNVKPVNVNEVKPINKGAEQ
IGFELVEKLFQGQLVLRTRCLECESLTERREDFQDISVPVQEDELSKVEESSEISPEPKT
EMKTLRWAISQFASVERIVGEDKYFCENCHHYTEAERSLLFDKMPEVITIHLKCFAASGL
EFDCYGGGLSKINTPLLTPLKLSLEEWSTKPTNDSYGLFAVVMHSGITISSGHYTASVKV
TDLNSLELDKGNFVIDQMCEIGKPEPLNEEEARGVVENYDDDEVSIRVSGNTQPSKVLNK
KNVEAIGLLGGQKSKADYELYNKASNPDKVASTAFAENRNSETNNTNGTHEFDTNKESSD
QTGINFSGFENKISCVVQSLKEYEGKWLLFDDSEVKVTEEKDFLNSLSPSTSPTSTPYLL
FYKKL
NT seq 2358 nt NT seq  +upstreamnt  +downstreamnt
atgcctggtgtcatacctagtgaaagtaatgggctttcaagaggtagcccgtcaaagaaa
aacagactttccttgaagttttttcagaaaaaggaaactaagagagccctggatttcacg
gattctcaagaaaatgaagaaaaggcttctgaatatagaggatctgaaattgatcaagtt
gtccctgcagcacagtcctcacctgtacactgtgagaagagagaaaacttactacccttt
gtgggactgaataatctcggcaacacttgttaccttaatagtatacttcaggtattatat
ttttgtcctggttttaaatctggagtgaagcacttattcaacattatttcaaggaagaaa
gaagccctaaaagatgaagccaatcaaaaagataagggaagttgcaaagaagattctttg
gcaagttatgaactaatatgcagtttacagtccttgatcatttcagttgaacagcttcag
gctagctttctcttaaatccagaaaaatacactgatgaacttgctactcagccaaggcga
ctgcttaacacactcagggaactcaaccctatgtatgaaggatatctacagcatgatgca
caggaagtattacagtgtattttgggaaacattcaagaaacatgccaactcctaaaaaaa
gaagaagtaaaaaatgtggtagaattatctactaagatagaagaaaaacctcatcagaaa
gaggaaatgagtggtattaacagcatagagatggacaatcttaggccttctgaagattat
aaagaaaaactcccaaaaggaaatgggaaaagaaaaagtgacactgaatttggtaacatg
aagaaaaaagttaaagtatccaaggaacaccagtcattggaagagaaccagagacaaacc
agatcaaaaaggaaagctacaggtgatacgttagagattccttctaaaataatccccaag
tgtgtttctgaaaatgaaagtgcaagaccctcacaaaagaaatcaagagttaaaataaat
tggttaaagcctgcaactaagcaacccagcattctttctaaattctgtagtctggggaaa
ataacaacaaaccagggatccaaagaacagttgaaagaaaatgaatatgatcttgaagag
gacttggggaagtgtgaaaatgataacacaactaatggttgtgaacttgaatctccaggg
gataatgttaagcccgttaatgttaatgaagttaagcccataaacaaaggtgcagagcaa
attggttttgagctagtagagaaattatttcaaggtcagctggtattaaggactcgttgc
ttagaatgtgaaagtttaacagaaagaagagaagattttcaggacatcagtgtgccagta
caagaagatgagctttccaaagtagaggagagttctgaaatttctccagagccaaaaaca
gaaatgaagaccctgagatgggcaatttcacagtttgcttcagtggagaggattgtagga
gaagataaatatttctgtgaaaattgccatcattatactgaagccgaacgaagtcttttg
tttgacaaaatgcctgaagttataactattcatttgaagtgctttgctgctagtggcttg
gagtttgattgttatggtggtggactttccaagatcaacactcctttactgacacctctt
aaattgtcactagaagaatggagcacaaagccaaccaacgacagctatggattatttgcg
gttgtgatgcacagtggcattaccatcagtagtgggcattacactgcttctgttaaagtc
accgaccttaacagtttagaactagataagggaaattttgtcatcgaccaaatgtgtgaa
ataggtaagccagaaccattgaatgaggaggaagcaaggggtgtggttgaaaattatgat
gatgatgaagtgtcaattagagttagtggaaatacacagccaagtaaagttttgaacaaa
aaaaatgtagaagctattggacttcttggaggacaaaagagcaaagcagattatgagcta
tacaacaaagcatctaatcctgataaagttgccagtacagcatttgctgaaaatagaaat
tctgagactaacaatactaatgggacccatgaatttgatacaaacaaagaatccagtgac
caaacaggcattaactttagtggatttgagaacaaaatttcatgtgtagtgcaaagctta
aaggagtatgaggggaaatggttactttttgatgattctgaagtgaaagttactgaagag
aaggactttttgaattctctttccccttctacatctcctacatctactccttatttgcta
ttttataagaaattatag

DBGET integrated database retrieval system