KEGG   Canis familiaris (dog): 479558Help
Entry
479558            CDS       T01007                                 

Gene name
USP24
Definition
ubiquitin specific peptidase 24
Orthology
K11840  
ubiquitin carboxyl-terminal hydrolase 9/24 [EC:3.1.2.15]
Organism
cfa  Canis familiaris (dog)
Brite
Enzymes [BR:cfa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     479558 (USP24)
Peptidases [BR:cfa01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   479558 (USP24)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
5
AA seq 2562 aa AA seqDB search
MEDGRGNWSRRLREDLQEKGALSYEPKELEITRFWIAQALPRKLCFVFKRKNDENGNCSG
EGIEFPTTNLYELESRVLTDHWSIPYKREESLGKCLLASTYLARLGLSESDENCKRFMDR
CMPEAFKKLLTSSAVHKWGTEIHEGIYNMLMLLIELVAERIKQDPIPTGLLGVLTMAFNP
DNEYHFKNRMKVSQRNWTEVFGEGNMFAVSPVSTFQKEPHGWVVDLVNKFGELGGFAAIQ
AKLHSEDIELGAVSALVQPLGVCAEYLNSSVVQPMLDPVILTTIQDVRSVEEKDLKDKRL
VSIPELLSAIKLLCMRFQPDLVTVVDDLRLDILLRMLKSPHFSAKMNSLKEVTKLIEDST
LSKSVKNAIDTDRLLDWLVENSVLSIALEGNIDQAQYCDRIKGIIELLGSKLSLDELTKI
WKIQSGQSSTVIENIHTIIAAAAVKFNSDQLNHLFVLIQKSWETESDRVRQKLLSLIGRI
GREARFETTSGKVLDVLWELAHLPTLPSSLIQQALEEHLTILSDAYAVKEAIKRSYIIKC
IEDIKRPGEWSGLEKNKKDGFKSSQLNNPQFVWVVPALRQLHEITRSFIKQTYQKQDKSI
IQDLKKNFEIVKLVTGSLIACHRLAAAVAGPGGLTGSTLVDGRYTYREYLEAHLKFLAFF
LQEATLYLGWNRAKEIWECLVTGQDVCELDREMCFEWFTKGQHDLESDVQQQLFKEKILK
LESYEITMNGFNLFKTFFENVNLCDHRLKRQGAQLYVEKLELIGMDFIWKIAMESPDEEI
ANEAIQLIINYSYINLNPRLKKDSVSLHKKFIADCYTRLEAASSALGGPTLTHAVTRATK
MLTATAMPTVATSVQSPYRSTKLVIIERLLLLAERYVITIEDFYSVPRTILPHGASFHGH
LLTLNVTYESTKDTFTVEAHSNETIGSVRWKIAKQLCSPVDNIQIFTNDSLLTVNKDQKL
LHQLGFSDEQILTVKTSGSGTPSGSSADSSTSSSSSSSGVFSSSYAMEQEKSLPGVVMAL
VCNVFDMLYQLANLEEPRITLRVRKLLLLIPTDPAIQEALDQLDSLGRKKTLLSDTSSQS
SKSPSLSSKQQHQPSASSILESLFRSFAPGMSTFRVLYNLEVLSSKLMPTADDDMARNCA
KSFCENFLKAGGLSLVVNVMQRDSIPSEVDYETRQGVYSICLQLARFLLVGQTMPTLLDE
DLTKDGIEALSSRPFRNVSRQTSRQMSLCGTPEKSSYRQLSVSDRSSIRVEEIIPAARVA
IQTMEVSDFTSTVACFMRLSWAAAAGRLDLVGSSQPIKESNSLFPAGIRNRLSSSGSNCS
SGSEGDPAALHAGICVRQQSVSTKDSLIAGEALSLLVTCLQLRSQQLASFYNLPCVADFI
IDILLGSPSAEIRRAACDQLYTLSQTDTSAHPDVQKPNQFLLGVILTAQLPLWSPTSIMR
GVNQRLLSQCMEYFDLRCQLLDDLTTSEMEQLRISPATMLEDEITWLDNFEPNRTAECET
SEADNILLAGHLRLIKTLLSLCGAEKEMLGSSLIKPLLDDFLFRASRIILNSHSPAGSAA
ISQQDFHPKCSTVNSRLAAYEVLVMLADSSPSNLQIITKELLSMHHQPDPALTKEFDYLP
PVDSRSSSGFVGLRNGGATCYMNAVFQQLYMQPGLPESLLSVDDDTDNPDDSVFYQVQSL
FGHLMESKLQYYVPENFWKIFKMWNKELYVREQQDAYEFFTSLIDQMDEYLKKMGRDQIF
KNTFQGIYSDQKICKDCPHRYEREEAFMALNLGVTSCQSLEISLDQFVRGEVLEGSNAYY
CEKCKEKRITVKRTCIKSLPSVLVIHLMRFGFDWESGRSIKYDEQIRFPWMLNMEPYTVS
GMARQDSSSEVGENGRSMDQGGGGSPRKKVALTENYELVGVIVHSGQAHAGHYYSFIKDR
RGCGKGKWYKFNDTVIEEFDLNDETLEYECFGGEYRPKVYDQTNPYTDVRRRYWNAYMLF
YQRVSDQNSPVLPKKSRVSVVRQEAEDLSLSAPSSPEISPQSSPRPHRPNNDRLSILTKL
VKKGEKKGLFVEKMPARIYQMVRDENLKFMKNRDVYSSDYFSFVLSLASLNATKLKHPYY
PCMAKVSLQLAIQFLFQTYLRTKKKLRVDTEEWIATIEALLSKSFDACQWLVEYFISSEG
RELIKIFLLECSVREVRVAVATILEKTLDSALFYQDKLKSLHQLLEVLLALLDKDVPENC
KNCAQYFFLFNTFVQKQGIRAGDLLLRHSALRHMTSFLLGANRQNNQIRRWSSAQAREFG
NLHNTVALLVLHSDVSSQRNVAPGLFKQRPPISVAPSSPLLPLHEEVEALLFLSEGKPYL
LEVMFALRELTGSLLALIEMVVYCCFCNEHFSFTMLHFIKNQLETAPPHELKNTFQLLHE
ILVIEDPIQVERVKFVFETENGLLALMHHSNHVDSSRCYQCVKFLVTLAQKCPAAKDYFK
ENSHHWSWAVQWLQKKMSEHYWTPQSNVSNETSTGKTFQRTISAQDTLAYATALLNEKEQ
SGSSNGSESSPANENGERHLQQGSESPMMIGELRSDLDDVDP
NT seq 7689 nt NT seq  +upstreamnt  +downstreamnt
atggaagatggaagaggaaactggtccagaaggttacgggaagatcttcaagagaaggga
gccttgagctatgaaccaaaagaactggagataaccagattttggattgctcaggcgctg
ccaagaaagttgtgcttcgttttcaaaaggaagaatgatgaaaatggaaactgctcaggg
gaaggaattgaattccctacaacgaatttgtatgaactggaaagccgagttttgactgat
cactggtccatcccttacaagcgggaagaatcactaggcaaatgcctgttggcgtctacc
tacctggccagacttggtctttccgagtctgatgagaattgtaaaagatttatggatagg
tgtatgcctgaagcatttaaaaagctcctgacttcgagtgctgttcacaagtggggtact
gaaattcatgaaggaatctacaacatgttgatgctattaatagaactggttgcagagaga
ataaaacaagacccgattcccactggtctcctgggtgtgcttacaatggctttcaatcct
gataatgagtaccattttaaaaacagaatgaaagtatctcaaaggaattggacagaagtg
tttggggagggaaatatgtttgctgtttcacctgtgtctactttccaaaaggagcctcat
ggatgggttgtggatttggtaaataagtttggagaattaggtggatttgcagcaatccaa
gccaagcttcattcagaagatatagaacttggggcggtgtcagcattggtgcagccctta
ggggtgtgtgcggagtacctcaattcctccgtggttcagccaatgctagacccggtcatc
cttactacaatacaggatgtgcggagcgtggaggagaaggacctcaaagataagagattg
gttagcatccccgagctcttgtctgccatcaagttactctgcatgcgtttccagccggat
ctagtgaccgtggtagacgaccttcgattagacatcctactgcgcatgttaaaatcacca
cattttagcgccaaaatgaattccctcaaagaagtaactaaactaatagaagatagcact
ttatccaaatctgtgaagaatgctatagatacagacagattgttagattggctggttgaa
aactcagttctgtcaattgcattagaaggcaacatagaccaagcacaatactgtgatcgt
ataaaagggattattgaactcttgggcagtaaattgtctttagatgaactcactaaaatt
tggaagatacagtcaggacaatcatctactgtgatcgagaacatccatactattattgct
gcagcagctgtcaaatttaattcagatcagcttaatcatttgtttgttctcatccagaag
agctgggagactgaaagtgatcgagtaagacagaagctgttgagtctgatcggacgaata
ggccgggaggctcgctttgagaccacttctggaaaggtgttagatgtactctgggagctg
gcacatcttccaaccctgcccagtagccttattcagcaagccttggaagagcatctgaca
atccttagtgatgcgtatgcggtgaaagaagcaatcaagaggagctacatcattaagtgc
atcgaagatattaaaaggcctggagaatggtcagggttggaaaaaaacaagaaggatgga
ttcaagtcatctcagcttaataatccccagtttgtgtgggtggtgccagctttgcgtcag
ctccacgagatcacccgctcgtttataaaacagacctatcaaaagcaagacaagagcatt
attcaagacttgaagaaaaattttgaaattgtaaaattagtaacgggaagtttgatagct
tgtcatcgacttgcagccgctgtggctggacccggaggcttaactggttcaacactggtg
gatggccgctacacttaccgggagtatttagaggcccatctaaaattcctagcatttttc
ttgcaagaagctactctgtatctgggttggaatcgtgccaaggaaatctgggagtgtctt
gtgactggccaagatgtttgtgaattagatagagagatgtgttttgaatggtttacaaaa
gggcaacatgatctcgaaagtgatgttcagcagcagcttttcaaggagaaaattcttaaa
ttggagtcctatgaaatcacaatgaatggttttaacttatttaagactttttttgaaaat
gtgaatctttgcgatcatcgattgaaacgacaaggagctcagttgtatgtagaaaagctg
gaattgataggaatggatttcatttggaaaatagccatggaatcacctgatgaagaaatt
gctaatgaagctattcagttaatcataaactatagttacattaacctgaatcctagatta
aaaaaggattctgtatcattacataagaaatttattgctgattgttacacaagattagaa
gcagccagttcagcacttggtggccccactctgacgcatgctgtgactagagcaactaaa
atgcttacagcaactgctatgccaactgtagcaacatcagttcagtctccatatagatcc
actaaacttgtaataatcgagagacttttgcttctggcagaacgctatgtgatcactatc
gaggatttttactctgttccacgaactattctacctcacggcgcctcatttcatggacat
cttttaactctcaatgttacgtatgaatctaccaaagataccttcactgtagaggctcac
agtaatgagaccataggaagtgtgcggtggaagatagccaagcagttgtgctcacctgtg
gacaacatacagatatttaccaacgatagtctgctgacggtgaataaagatcaaaagctc
ctccaccagctgggcttttccgatgaacagatcctcacagtgaagacttcaggcagtggg
accccttccgggagctccgcggattcctcaaccagctccagcagcagcagcagtggggtc
ttcagctcctcttacgccatggaacaggagaaatccctccctggtgttgtaatggcactt
gtatgtaatgtgttcgacatgctctaccagcttgccaatctggaggagccaaggataact
ctacgagtacgaaagcttctgctcttgatacccactgacccagccattcaggaagccctg
gatcaacttgattccttaggaagaaagaaaacgttactgtctgacacgagctctcaatcc
tcaaagtctccatccctgtcctccaagcagcagcatcagccaagcgccagctcaatcttg
gaaagtctgtttcgatcctttgctccaggaatgtccaccttcagagtgctctacaactta
gaagttctaagctccaaactcatgcccacagctgatgatgacatggcaagaaactgtgca
aaatccttctgcgagaacttcctcaaagcaggaggattgagtttggttgtaaatgtcatg
cagagggattccatcccatcagaagtagactatgagacaaggcaaggagtttactctatc
tgtctacaacttgcaagatttttacttgttgggcaaacaatgcccacattactagatgaa
gacctcaccaaagatggcatagaagcactttcttctcgcccattccgaaatgtcagccgg
caaacaagcaggcagatgtccttatgtggtaccccagaaaagtcatcctaccgacagttg
tccgtgtctgacaggtcttctattagagtcgaggaaatcatccctgctgcacgtgttgca
atacaaacaatggaagtaagtgacttcacatctactgtggcttgtttcatgaggttgtcc
tgggctgcagctgcaggacggctcgacctcgttgggagtagccaaccaattaaagaaagt
aattctctgtttcctgctggaattcgaaacagactcagcagttcaggaagcaattgcagc
tctgggagtgaaggggacccagcagccctgcacgcgggcatctgtgtgcgacaacaatct
gtgtccaccaaagactcgctgattgccggggaagctctgtctcttcttgttacatgcctg
cagctacggagccagcaactagcatctttctataacttgccctgtgttgctgattttatt
attgatattctgctcggatcaccaagtgctgagattcgccgtgctgcctgtgaccagctg
tatactctgagtcagacagatacttcagctcacccagacgtacagaagccaaaccagttt
ctcctcggggtgatcctcacagctcagctacctctctggtccccaactagtattatgaga
ggagtcaatcagagactattatctcagtgtatggagtattttgatctaaggtgccaatta
ttagatgatctgacaacttcagaaatggagcagttaagaatcagcccagctactatgctt
gaggatgagattacctggctggataactttgaacctaatcgcactgctgaatgtgagacc
agtgaagcagacaacatcttattggcaggacacttacggctcattaagactctcctttca
ctctgtggggcagaaaaggaaatgcttggttcatcactcattaaaccattgttagatgac
ttccttttccgagcttctagaattattttaaatagtcattctccagctggcagtgccgcc
atcagtcaacaggactttcatccaaagtgtagtacagtgaatagccgattggcagcctat
gaagtcctggtgatgttggctgatagctcaccttcaaatctgcaaattatcacaaaagaa
ctgctgtctatgcatcatcaacccgaccctgctctaaccaaggagtttgattaccttccc
cctgtggatagcaggtccagttcagggtttgtggggctgaggaatggcggtgctacgtgt
tacatgaatgcagtcttccagcagctgtatatgcagcctgggctccctgagtcgttactt
tcagtggatgatgacacggacaatccagacgatagcgtgttctaccaggtgcagtcgctc
tttgggcatctgatggaaagcaagctgcagtattatgtacctgagaacttctggaagatt
ttcaagatgtggaacaaagagctttatgtgcgagaacagcaagatgcatatgaattcttc
actagtcttattgatcagatggacgaatatctcaagaaaatggggagagaccaaattttt
aagaatactttccagggcatctattctgatcagaagatctgtaaagactgtcctcacaga
tacgagcgtgaggaagctttcatggctctcaatcttggagttacttcttgtcagagcttg
gaaatttctttggatcagtttgttagaggagaagttctagaaggaagtaatgcatattac
tgtgaaaagtgtaaagaaaagagaataaccgtgaaaaggacctgcattaagtctttacct
agcgtcttggtaattcacctaatgagatttggatttgactgggagagtggacgctccatt
aaatatgatgaacagataaggtttccctggatgctaaacatggagccttacacagtttca
ggaatggctcgccaagattcatcttctgaagttggtgaaaacgggcgaagtatggaccag
ggagggggaggatccccacgaaaaaaagttgccctcactgaaaactatgaacttgtcggt
gtcattgtccacagtgggcaggcacatgcaggtcactactattccttcattaaggacagg
cggggctgtggaaaaggaaagtggtacaagtttaatgacacagtcatagaagaatttgac
ctaaatgatgagaccctggagtatgaatgctttggaggagaatatagaccaaaagtttat
gatcaaacaaacccatatactgacgtccgccgaagatactggaatgcctatatgctcttc
taccaaagggtctctgatcaaaactccccagtattaccaaagaaaagtcgagtcagtgtc
gtacggcaagaagctgaggatctctctttgtcagcaccgtcttcaccagagatttcacct
cagtcgtctccccggccccacaggcctaacaatgaccggctctctattctcaccaagctg
gttaaaaaaggcgagaagaaaggactctttgtggagaaaatgcctgctcgaatataccag
atggtgagagatgaaaacctcaagtttatgaagaatagagatgtgtacagtagtgattat
ttcagttttgttttgtctttagcatcattgaatgctactaaattaaagcatccatattat
ccttgcatggcaaaggtgagcttacagcttgctattcagttcctttttcaaacttaccta
cggacaaagaaaaaactcagggttgatactgaagaatggattgccactattgaagcatta
ctttccaaaagttttgatgcttgtcagtggctagttgaatattttattagctctgaagga
cgagaattaataaagattttcttgttggagtgcagtgtgagagaagtgcgagttgccgtg
gccaccattctggagaaaactctagacagtgccttgttttatcaggataagttaaaaagc
cttcatcagttactggaagtactacttgctctgttggataaagatgtcccagaaaactgt
aaaaactgtgctcagtactttttcctattcaacacttttgtacaaaagcaaggcattcgg
gctggggatcttcttctgaggcattcagctctgcgacacatgaccagctttctcctcggg
gccaaccggcaaaacaatcagatacgtcggtggagttcagcacaagcacgagaatttggg
aatcttcataatacagtggcattactggttttgcattcagacgtctcttctcaaaggaat
gttgctcctggtctatttaagcaacggccacccattagtgtcgccccctccagccccttg
ctgcccctccacgaggaagtagaggccttgttgttcctgtctgaagggaagccttacctg
ttagaggtaatgtttgctttgcgagagctgaccggctctctcctagctctcatcgagatg
gtcgtgtactgctgtttctgtaatgagcacttctccttcaccatgctgcatttcattaag
aatcaactagaaacagctccaccccatgagctaaagaatacgttccagctacttcatgag
atactggtcattgaagatcccatacaagtggagcgggtcaaatttgtatttgagacagaa
aacggtttattagccctgatgcaccacagcaaccatgtggacagcagtcgctgctaccag
tgtgtcaaatttcttgtaactcttgctcaaaagtgtcctgctgctaaggactacttcaag
gagaattcccaccattggagctgggccgtacagtggctgcaaaagaagatgtcagaacat
tattggacaccacagagtaatgtctctaatgaaacatcaactggaaaaacctttcagcga
acaatttcggctcaggacacattagcctatgccacagctttgctgaatgagaaagagcaa
tctggaagcagtaatgggtcggagagcagtcccgcaaatgagaacggagagaggcattta
caacagggttcagagtcccccatgatgattggtgagttgagaagtgaccttgacgatgtg
gatccctag

DBGET integrated database retrieval system