KEGG   Canis familiaris (dog): 479625Help
Entry
479625            CDS       T01007                                 

Gene name
USP10
Definition
ubiquitin specific peptidase 10
Orthology
K11841  
ubiquitin carboxyl-terminal hydrolase 10 [EC:3.1.2.15]
Organism
cfa  Canis familiaris (dog)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
5
AA seq 850 aa AA seqDB search
MDGRVFGTHRGGRPVAFGAPLGDPGAERPCGSRPGRAQVAPPGSGRSRVSPSTRVASRQY
IFGDFSPDEFNQFFVTPRSSVELPPYNGAVLCGTQATDELPDGQEYQRIEFGVNEVIEPN
DTLPRTPNYSISSTLNPQAPEFILSCTTSKKPPDDLDKEATYSSVDCQYPGSALALDGSS
SAEVEVLESDGVSGGLGQRERKKKKKRPPGYYSYLKDGGEGSIPTEALVNGHANSAVPNI
VGSEDAELVGEVPPSGTPRTCSSPQDSTDFVSDAVPGGPFPGALDGDTRTAGQPEGCHGA
DLEQSCLSTEAGRDSLLRTAVAQPYMGTHTTENLGVANGQILESSGEGSAANGVELHTVE
STDSDPAKAESTSPAADTPASVAGTAPTSQPKSWASLFHDSKPSSSSPVASVETKYSPPA
TSPLVSEKQIEVKEGLVPVSEDPVAIKIAELLENVTLIHKPVSLQPRGLINKGNWCYINA
TLQALVACPPMYHLMKFIPLYSKVQRPCTSTPMIDSFVRLMNEFTNMPVPPKPRQALGDK
IVRDIRPGAAFEPTYIYRLLTVIKSSLSEKGRQEDAEEYLGFILNGLHEEMLSLKKLLSP
NNEKLTISNGPKSHSVTEDDQEEPGEGSEDEWEQVGPRNKTSVTRQAEFVQTPITGIFGG
HIRSVVYQQSSKESATLQPFFTLQLDIQSDRIRTVQDALESLVARESVQGYTTKTKQEVE
ISRRVTLEKLPPVLVLHLKRFVYEKTGGCQKLIKNIEYPVDLEISKELLSPGVKNKNFKC
HRTYRLFAVVYHHGSSATGGHYTTDVFQIGLNGWLRIDDQAVKVINQYQVVKPTAERTAY
LLYYRRVDLL
NT seq 2553 nt NT seq  +upstreamnt  +downstreamnt
atggacggaagggtgttcggcacccacaggggagggcgcccggtggccttcggcgctccc
ctgggagacccgggtgcagagagaccctgcggctcccgccccgggcgagctcaggtggcg
cctccaggctccggacggtcccgcgtctcgcccagcacccgggtggcctcccggcagtat
atttttggagattttagccctgatgaattcaatcagttctttgtgactcctcgctcttca
gttgagcttcccccatacaatggagcagtgctgtgtggcacacaagctacagatgagcta
cctgatggacaagaatatcagagaattgaatttggtgttaatgaagtaattgaacccaat
gacactttgccgagaactcccaactacagtatttcaagcacattgaatcctcaggcccct
gaatttattctcagttgcacaacttccaaaaaaccccctgatgacctagataaagaagct
acctacagctcagttgactgccagtacccaggctctgcccttgccctggatggcagttct
agcgcggaggttgaagttttagaaagtgatggtgtttcgggtggtcttggacaaagggag
cgtaaaaagaagaaaaaacgtcccccaggatattacagttacttgaaagatggtggtgag
ggtagtattcccacggaagccctggtcaatggccacgccaattcggcagtcccaaacatc
gtaggctcagaggatgcagagttagtgggtgaggtgcccccatcggggacgcccaggact
tgtagcagccctcaggattccacggacttcgtcagtgacgctgtgcctggtgggcctttc
cctggagccctcgatggtgataccaggactgcagggcagcctgagggctgccacggggct
gacttggaacagtcctgcctctctacggaggctggcagggacagcctgttgaggacagct
gtggctcagccttacatgggaactcatactactgaaaaccttggagttgctaacggacaa
atacttgaatcctccggtgagggctcagctgccaacggagtcgagttgcacactgtggag
agcacggactcggacccagctaaggccgagagcacttcccctgctgccgacaccccggcc
tctgtggcgggcactgctcccaccagccagcctaagtcatgggccagcctttttcatgat
tctaagccctcttcctcttcacctgtggcttctgtggaaactaagtattcccctcctgcc
acatctcccctggtctctgaaaagcagattgaagtcaaagaagggcttgttccagtttca
gaggatcctgtagccataaagattgcagagttactggagaatgtaaccctaatacataaa
ccagtgtcattgcaaccccgtgggctgatcaataaaggaaactggtgctacattaatgct
acgctgcaggcactggttgcttgccctccgatgtatcacctgatgaagttcattcctctg
tattcaaaagtgcaaaggccttgtacatcgacacccatgatagatagctttgttcggcta
atgaatgagtttactaatatgccagtacctccaaaacccagacaagctcttggggataaa
atcgtgagagatatccgccctggagctgcttttgaacctacgtatatttacagacttctg
acagttatcaagtcgagcctgtcggaaaagggtcgacaagaagatgctgaggagtactta
ggcttcattctaaatggacttcatgaggaaatgctcagcctaaagaagctcctgtcaccg
aacaatgaaaaactcactatttccaatggacccaaaagtcactcggtgactgaagacgac
caggaagaaccaggcgaaggaagtgaggacgaatgggagcaagtgggccccagaaataag
acttcagtcactcgccaggcggagtttgttcagaccccaatcactggcatttttggtgga
cacatcaggtctgtggtttaccagcagagttcaaaggagtcggccactttgcagccattc
ttcaccttgcagctggacatccagtctgacaggatccgtacggtccaggatgcattggag
agcttggtggcaagagaatctgtccagggttataccacgaaaaccaaacaagaggtggag
ataagccgacgagtaactctggagaagctccctcctgttcttgtgctgcacctgaaacgg
tttgtttacgagaagactggtggatgccagaagctcataaaaaatattgaatatcctgtg
gacttggaaatcagtaaagaactgctttctccaggggttaaaaataagaattttaaatgc
cacagaacctataggctatttgcagtggtctaccaccatggcagcagtgcgacgggtggc
cactacaccacagacgtcttccagattggcctcaacggctggctgcgcatcgatgaccag
gcggtcaaggtgatcaaccagtaccaagtggtgaagcccactgcggagcgcacagcctac
ctcctgtattaccgccgtgtggacctgctgtag

DBGET integrated database retrieval system