KEGG   Canis familiaris (dog): 479625Help
Entry
479625            CDS       T01007                                 

Gene name
USP10
Definition
ubiquitin specific peptidase 10
Orthology
K11841  
ubiquitin carboxyl-terminal hydrolase 10 [EC:3.4.19.12]
Organism
cfa  Canis familiaris (dog)
Brite
Enzymes [BR:cfa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     479625 (USP10)
Peptidases [BR:cfa01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   479625 (USP10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
5
AA seq 850 aa AA seqDB search
MDGRVFGTHRGGRPVAFGAPLGDPGAERPCGSRPGRAQVAPPGSGRSRVSPSTRVASRQY
IFGDFSPDEFNQFFVTPRSSVELPPYNGAVLCGTQATDELPDGQEYQRIEFGVNEVIEPN
DTLPRTPNYSISSTLNPQAPEFILSCTTSKKPPDDLDKEATYSSVDCQYPGSALALDGSS
SAEVEVLESDGVSGGLGQRERKKKKKRPPGYYSYLKDGGEGSIPTEALVNGHANSAVPNI
VGSEDAELVGEVPPSGTPRTCSSPQDSTDFVSDAVPGGPFPGALDGDTRTAGQPEGCHGA
DLEQSCLSTEAGRDSLLRTAVAQPYMGTHTTENLGVANGQILESSGEGSAANGVELHTVE
STDSDPAKAESTSPAADTPASVAGTAPTSQPKSWASLFHDSKPSSSSPVASVETKYSPPA
TSPLVSEKQIEVKEGLVPVSEDPVAIKIAELLENVTLIHKPVSLQPRGLINKGNWCYINA
TLQALVACPPMYHLMKFIPLYSKVQRPCTSTPMIDSFVRLMNEFTNMPVPPKPRQALGDK
IVRDIRPGAAFEPTYIYRLLTVIKSSLSEKGRQEDAEEYLGFILNGLHEEMLSLKKLLSP
NNEKLTISNGPKSHSVTEDDQEEPGEGSEDEWEQVGPRNKTSVTRQAEFVQTPITGIFGG
HIRSVVYQQSSKESATLQPFFTLQLDIQSDRIRTVQDALESLVARESVQGYTTKTKQEVE
ISRRVTLEKLPPVLVLHLKRFVYEKTGGCQKLIKNIEYPVDLEISKELLSPGVKNKNFKC
HRTYRLFAVVYHHGSSATGGHYTTDVFQIGLNGWLRIDDQAVKVINQYQVVKPTAERTAY
LLYYRRVDLL
NT seq 2553 nt NT seq  +upstreamnt  +downstreamnt
atggacggaagggtgttcggcacccacaggggagggcgcccggtggccttcggcgctccc
ctgggagacccgggtgcagagagaccctgcggctcccgccccgggcgagctcaggtggcg
cctccaggctccggacggtcccgcgtctcgcccagcacccgggtggcctcccggcagtat
atttttggagattttagccctgatgaattcaatcagttctttgtgactcctcgctcttca
gttgagcttcccccatacaatggagcagtgctgtgtggcacacaagctacagatgagcta
cctgatggacaagaatatcagagaattgaatttggtgttaatgaagtaattgaacccaat
gacactttgccgagaactcccaactacagtatttcaagcacattgaatcctcaggcccct
gaatttattctcagttgcacaacttccaaaaaaccccctgatgacctagataaagaagct
acctacagctcagttgactgccagtacccaggctctgcccttgccctggatggcagttct
agcgcggaggttgaagttttagaaagtgatggtgtttcgggtggtcttggacaaagggag
cgtaaaaagaagaaaaaacgtcccccaggatattacagttacttgaaagatggtggtgag
ggtagtattcccacggaagccctggtcaatggccacgccaattcggcagtcccaaacatc
gtaggctcagaggatgcagagttagtgggtgaggtgcccccatcggggacgcccaggact
tgtagcagccctcaggattccacggacttcgtcagtgacgctgtgcctggtgggcctttc
cctggagccctcgatggtgataccaggactgcagggcagcctgagggctgccacggggct
gacttggaacagtcctgcctctctacggaggctggcagggacagcctgttgaggacagct
gtggctcagccttacatgggaactcatactactgaaaaccttggagttgctaacggacaa
atacttgaatcctccggtgagggctcagctgccaacggagtcgagttgcacactgtggag
agcacggactcggacccagctaaggccgagagcacttcccctgctgccgacaccccggcc
tctgtggcgggcactgctcccaccagccagcctaagtcatgggccagcctttttcatgat
tctaagccctcttcctcttcacctgtggcttctgtggaaactaagtattcccctcctgcc
acatctcccctggtctctgaaaagcagattgaagtcaaagaagggcttgttccagtttca
gaggatcctgtagccataaagattgcagagttactggagaatgtaaccctaatacataaa
ccagtgtcattgcaaccccgtgggctgatcaataaaggaaactggtgctacattaatgct
acgctgcaggcactggttgcttgccctccgatgtatcacctgatgaagttcattcctctg
tattcaaaagtgcaaaggccttgtacatcgacacccatgatagatagctttgttcggcta
atgaatgagtttactaatatgccagtacctccaaaacccagacaagctcttggggataaa
atcgtgagagatatccgccctggagctgcttttgaacctacgtatatttacagacttctg
acagttatcaagtcgagcctgtcggaaaagggtcgacaagaagatgctgaggagtactta
ggcttcattctaaatggacttcatgaggaaatgctcagcctaaagaagctcctgtcaccg
aacaatgaaaaactcactatttccaatggacccaaaagtcactcggtgactgaagacgac
caggaagaaccaggcgaaggaagtgaggacgaatgggagcaagtgggccccagaaataag
acttcagtcactcgccaggcggagtttgttcagaccccaatcactggcatttttggtgga
cacatcaggtctgtggtttaccagcagagttcaaaggagtcggccactttgcagccattc
ttcaccttgcagctggacatccagtctgacaggatccgtacggtccaggatgcattggag
agcttggtggcaagagaatctgtccagggttataccacgaaaaccaaacaagaggtggag
ataagccgacgagtaactctggagaagctccctcctgttcttgtgctgcacctgaaacgg
tttgtttacgagaagactggtggatgccagaagctcataaaaaatattgaatatcctgtg
gacttggaaatcagtaaagaactgctttctccaggggttaaaaataagaattttaaatgc
cacagaacctataggctatttgcagtggtctaccaccatggcagcagtgcgacgggtggc
cactacaccacagacgtcttccagattggcctcaacggctggctgcgcatcgatgaccag
gcggtcaaggtgatcaaccagtaccaagtggtgaagcccactgcggagcgcacagcctac
ctcctgtattaccgccgtgtggacctgctgtag

DBGET integrated database retrieval system