KEGG   Canis familiaris (dog): 479649Help
Entry
479649            CDS       T01007                                 

Definition
chymostrypsinogen B1-like (EC:3.4.21.1)
Orthology
K01310  
chymotrypsin [EC:3.4.21.1]
Organism
cfa  Canis familiaris (dog)
Brite
Enzymes [BR:cfa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.1  chymotrypsin
     479649
Peptidases [BR:cfa01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   479649
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
5
AA seq 263 aa AA seqDB search
MAFLWLLSCFALLGTAFGCGVPAIQPVLSGLSRIVNGEDAVPGSWPWQVSLQDSTGFHFC
GGSLISEDWVVTAAHCGVRTTHQVVAGEFDQGSDAESIQVLKIAKVFKNPKFNMFTINND
ITLLKLATPARFSKTVSAVCLPQATDDFPAGTLCVTTGWGLTKHTNANTPDKLQQAALPL
LSNAECKKFWGSKITDLMVCAGASGVSSCMGDSGGPLVCQKDGAWTLVGIVSWGSGTCST
STPGVYARVTKLIPWVQQILQAN
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atggctttcctctggctcctctcctgcttcgccctcctgggcacagccttcggctgcggg
gtccccgccatccagccggtgttaagtggcctgtccaggatcgtcaatggggaagacgct
gtcccgggctcctggccctggcaggtgtccctgcaggacagcaccggcttccacttctgc
ggggggtccctcatcagcgaggactgggtggtcactgctgcccactgcggggtcagaacc
acccaccaggttgtagccggggagttcgaccagggctcagatgctgagagcatccaggtg
ctgaagattgccaaggttttcaagaaccccaagttcaacatgttcaccatcaacaacgac
atcaccctgctgaagctggccacacccgcccgcttctccaagaccgtgtccgccgtgtgc
ctgccccaggcgaccgacgacttccctgctgggaccctgtgtgtcaccacgggctggggc
ctgaccaaacacaccaatgccaacacccccgacaagctacagcaggcggccctgcccctc
ctgtccaacgccgagtgcaagaagttctggggcagcaagatcaccgatcttatggtctgt
gcgggtgccagtggcgtctcctcctgcatgggtgactctggtggccccctggtctgccag
aaggatggagcctggactctggtgggcatcgtgtcctggggcagcggtacctgctccacc
tccactcctggcgtgtacgcccgtgtcaccaagctcataccctgggtacagcagatccta
caagccaactga

DBGET integrated database retrieval system