KEGG   Canis familiaris (dog): 479650Help
Entry
479650            CDS       T01007                                 

Gene name
CTRB2
Definition
chymotrypsinogen B2
Orthology
K01310  
chymotrypsin [EC:3.4.21.1]
Organism
cfa  Canis familiaris (dog)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
5
AA seq 263 aa AA seqDB search
MAFLWLLSCFALVGAASNCGVPAIEPVLNGLSRIVNGEDAVPGSWPWQVSLQDSTGFHFC
GGSLISEDWVVTAAHCGVRTSHLVVAGEFDQSSSEENIQVLKIAEVFKNPKFNMFTVRND
ITLLKLATPARFSETVSPVCLPQATDEFPPGLMCVTTGWGRTKYNANKTPDKLQQAALPL
LSNAECKKFWGSKITDVMICAGASGVSSCMGDSGGPLVCQKDGAWTLVGIVSWGSGTCST
SVPAVYSRVTELIPWVQEILAAN
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atggcctttctgtggcttctctcctgcttcgcccttgtgggggccgcctccaactgcggg
gtccccgccatcgaacctgtcctgaacggcctgtccaggatcgtcaatggggaagacgcc
gtcccgggctcctggccctggcaggtgtcgctgcaggacagcaccggcttccacttctgc
ggggggtccctcatcagcgaggactgggtggtcacggccgcccactgcggggtcaggacc
tctcacctggtcgtggccggggagtttgaccagagctcaagtgaagagaacatccaggtc
ctgaagatcgccgaggtgttcaagaaccccaagttcaacatgttcacggtccgcaacgac
atcaccctgctgaagctggccacgcccgcccgcttctccgagaccgtgtcccccgtgtgc
ctgccccaggcgaccgacgagttccccccgggtttgatgtgcgtcaccaccggctggggg
cggaccaagtacaacgccaacaagacgcccgacaagctgcagcaggcggccctgcccctc
ctgtccaacgccgagtgcaagaagttctggggcagcaagatcaccgacgtgatgatttgc
gccggtgccagcggcgtctcctcctgcatgggtgactctggtggccccctggtctgccag
aaggatggagcctggaccctggtgggcatcgtgtcctggggcagcggcacctgctccacc
tctgttcctgctgtgtactcccgtgtcactgagctcattccttgggttcaggaaatactt
gctgccaactga

DBGET integrated database retrieval system