KEGG   Canis familiaris (dog): 479733Help
Entry
479733            CDS       T01007                                 

Gene name
GNB2
Definition
(RefSeq) G protein subunit beta 2
  KO
K04537  guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2
Organism
cfa  Canis familiaris (dog)
Pathway
cfa04014  Ras signaling pathway
cfa04062  Chemokine signaling pathway
cfa04151  PI3K-Akt signaling pathway
cfa04371  Apelin signaling pathway
cfa04713  Circadian entrainment
cfa04723  Retrograde endocannabinoid signaling
cfa04724  Glutamatergic synapse
cfa04725  Cholinergic synapse
cfa04726  Serotonergic synapse
cfa04727  GABAergic synapse
cfa04728  Dopaminergic synapse
cfa04926  Relaxin signaling pathway
cfa05032  Morphine addiction
cfa05034  Alcoholism
cfa05167  Kaposi's sarcoma-associated herpesvirus infection
cfa05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    479733 (GNB2)
   04371 Apelin signaling pathway
    479733 (GNB2)
   04151 PI3K-Akt signaling pathway
    479733 (GNB2)
 Organismal Systems
  Immune system
   04062 Chemokine signaling pathway
    479733 (GNB2)
  Endocrine system
   04926 Relaxin signaling pathway
    479733 (GNB2)
  Nervous system
   04724 Glutamatergic synapse
    479733 (GNB2)
   04727 GABAergic synapse
    479733 (GNB2)
   04725 Cholinergic synapse
    479733 (GNB2)
   04728 Dopaminergic synapse
    479733 (GNB2)
   04726 Serotonergic synapse
    479733 (GNB2)
   04723 Retrograde endocannabinoid signaling
    479733 (GNB2)
  Environmental adaptation
   04713 Circadian entrainment
    479733 (GNB2)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    479733 (GNB2)
  Substance dependence
   05032 Morphine addiction
    479733 (GNB2)
   05034 Alcoholism
    479733 (GNB2)
  Infectious diseases
   05167 Kaposi's sarcoma-associated herpesvirus infection
    479733 (GNB2)
Exosome [BR:cfa04147]
 Exosomal proteins
  Proteins found in most exosomes
   479733 (GNB2)
GTP-binding proteins [BR:cfa04031]
 Heterotrimeric G-proteins
  Beta Subunits
   Beta [OT]
    479733 (GNB2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: WD40 ANAPC4_WD40 WD40_like eIF2A CALM_bind Cytochrom_D1
Motif
Other DBs
NCBI-GeneID: 479733
NCBI-ProteinID: XP_536861
Ensembl: ENSCAFG00000014282
UniProt: E2RD95
Position
6
AA seq 340 aa AA seqDB search
MSELEQLRQEAEQLRNQIRDARKACGDSTLTQITAGLDPVGRIQMRTRRTLRGHLAKIYA
MHWGTDSRLLVSASQDGKLIIWDSYTTNKVHAIPLRSSWVMTCAYAPSGNFVACGGLDNI
CSIYSLKTREGNVRVSRELPGHTGYLSCCRFLDDNQIITSSGDTTCALWDIETGQQTVGF
AGHSGDVMSLSLAPDGRTFVSGACDASIKLWDVRDSMCRQTFIGHESDINAVAFFPNGYA
FTTGSDDATCRLFDLRADQELLMYSHDNIICGITSVAFSRSGRLLLAGYDDFNCNIWDAM
KGDRAGVLAGHDNRVSCLGVTDDGMAVATGSWDSFLKIWN
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgagtgagctggagcaactgagacaggaggctgagcagctccggaaccagatccgggat
gcccgaaaagcatgtggggattcaacactgacccagatcacagctgggctggacccagtg
gggaggatccagatgaggacaaggaggaccctccgtgggcacctggcaaaaatctatgcc
atgcactgggggacagactcaaggctgctggtcagcgcctcccaggatgggaagctcatc
atttgggacagctataccaccaacaaggtccatgccatccctctgcgctcctcctgggtc
atgacctgtgcctatgcgccctcagggaactttgtggcctgtggggggctggacaacatc
tgctccatctacagcctcaagacccgcgagggcaatgtcagggtcagccgggagctgcct
ggccacactgggtacctgtcgtgctgccgcttcctggatgacaaccaaatcatcaccagc
tctggggacaccacctgtgccctgtgggacattgagacaggccagcagacagtgggtttt
gctggacacagcggagatgtgatgtccctatcgctggcccccgatggccgcacctttgtg
tcaggtgcctgtgacgcctccatcaagctgtgggacgtgcgggattctatgtgccgacag
accttcattggccacgagtcagacatcaatgctgtggcattcttccccaatggctatgcc
ttcaccactggctccgacgacgccacttgccgcctcttcgacctgcgggctgaccaggag
ctgctcatgtactcccatgacaacatcatctgtggcatcacctctgttgccttctcccgc
agcggccggctgctgctcgccggctatgatgacttcaactgcaacatctgggacgccatg
aaaggcgaccgcgcaggtgtcctcgccggccacgacaaccgtgtgagctgcctcggggtc
actgatgatggcatggctgtggccacaggctcctgggactccttcctcaagatctggaac
taa

DBGET integrated database retrieval system