KEGG   Canis familiaris (dog): 479740Help
Entry
479740            CDS       T01007                                 

Gene name
CYP3A4, CYP3A12
Definition
cytochrome P450, family 3, subfamily A, polypeptide 4
Orthology
K07424  
cytochrome P450, family 3, subfamily A [EC:1.14.14.1]
Organism
cfa  Canis familiaris (dog)
Pathway
Steroid hormone biosynthesis
Linoleic acid metabolism
Retinol metabolism
Metabolic pathways
Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    479740 (CYP3A4)
   00591 Linoleic acid metabolism
    479740 (CYP3A4)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    479740 (CYP3A4)
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    479740 (CYP3A4)
Enzymes [BR:cfa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     479740 (CYP3A4)
Cytochrome P450 [BR:cfa00199]
 Cytochrome P450, animal type
  CYP3 family
   479740 (CYP3A4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
6
AA seq 503 aa AA seqDB search
MDLIPSFSMETWLLLATSLVLLYLYGTYTHGVFKKLGIPGPTPLPFVGTALGYRKGFSVF
DENCFRKYGRMWGFYDGRQPVLAITDPDMIKTVLVKECYSVFTNRRSFGPVGFMKSAISL
SEDEEWKRIRTLLSPTFTSGKLKEMFPIIGQYGDVLVRNLRKEAEKGKSINLKDIFGAYS
MDVITSTSFGVNIDSLNNPQDPFVENIKKLLKFDFLDPFFFSILLFPFLTPVFEVLNIWL
FPKSVTDFFTKSVKRMKENRLKDKQKHRVDFLQLMINSQNSKETDTHKALSDLELVAQSI
IFIFAGYETTSTSLSFLMYELATHPDVQQKLQEEIDATFPNKALPTYDALVQMEYLDMVL
NETLRLYPIAGRLERVCKKDVEISGVFIPKGTVVMVPTFTLHRDQSLWPEPEEFRPERFS
RKNKDSINPYTYLPFGTGPRNCIGMRFAIMNMKLALVRVLQNFSFKPCKETQIPLKLNAQ
GIIQPEKPIVLKVEPRDGSVNGA
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atggacctaatcccaagcttttccatggaaacctggcttctcctggctaccagcctggtg
ctcctctatctgtatgggacctacacacatggggtttttaagaagctaggaattcctgga
ccaacacctctgccttttgtgggaactgctctgggctaccgtaagggtttttctgttttt
gatgagaactgttttaggaagtatggaagaatgtgggggttttatgatgggcgacagcct
gtgctggctatcacagatccggacatgatcaaaacagtgctagtgaaagaatgttattct
gtcttcacaaaccggcggtcttttggtccagtgggatttatgaaaagtgccatctctctg
tctgaggatgaagaatggaagagaatacgaacattgctgtccccaaccttcaccagtgga
aagctcaaggagatgttccccatcattggccagtatggagatgtgttggtgaggaacctg
aggaaggaggcagagaaaggcaaatccatcaacttgaaagacatctttggagcctacagc
atggatgtgattaccagcacatcatttggagtgaacattgattccctcaacaacccacaa
gatccctttgtggaaaatatcaagaagctcttaaaatttgatttccttgatccatttttc
ttctcaatattactgtttccattccttaccccagtttttgaagtattaaatatctggctc
tttccaaaaagtgttactgattttttcacaaaatctgtaaaaagaatgaaggaaaatcgc
ctcaaagataaacaaaagcatcgagtggactttcttcagctgatgattaactcccagaat
tctaaagaaacagacactcataaagctctatctgatttggagctggtggcccaatctatt
atctttatttttgctggctatgagaccactagcacttctctttccttccttatgtatgaa
ttggccactcaccctgatgtccagcagaaactgcaggaggagattgatgcgactttcccc
aataaggcattgcccacttacgatgcccttgtgcagatggaatatctggacatggtgttg
aatgaaactctccgattatacccaatcgctggtagacttgagagggtctgtaagaaagat
gtggaaatcagtggtgtgttcattcccaaagggacagtggtgatggtgccaacctttact
cttcatcgagaccagagtctctggccagagcctgaggaattccgacctgaaaggttcagt
aggaagaacaaggacagcataaatccttatacatacctgccttttggaactggaccccga
aactgcattggaatgaggtttgcgatcatgaacatgaaacttgcccttgttagggtcctg
cagaacttctccttcaaaccttgtaaagaaacacagatccccctgaaattaaatgctcaa
gggattattcaacctgaaaagcccattgttctcaaggttgagccaagagatgggagtgta
aatggagcctga

DBGET integrated database retrieval system