KEGG   Canis familiaris (dog): 479754Help
Entry
479754            CDS       T01007                                 

Gene name
USP42
Definition
ubiquitin specific peptidase 42
Orthology
K11855  
ubiquitin carboxyl-terminal hydrolase 36/42 [EC:3.1.2.15]
Organism
cfa  Canis familiaris (dog)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6
AA seq 1339 aa AA seqDB search
MTIVDKASESSDPSTYQNQPGSSEAVSPGDMDAGSASWGAVSSLNDVSNHTLSLGPVPGA
VVYSSSSVPDKSKPSPQKDQALGDGIAPPQKVLFPSEKICLKWQQTHRVGAGLQNLGNTC
FANAALQCLTYTPPLANYMLSHEHSKTCHAEGFCMMCTMQAHITQALSNPGDVIKPMFVI
NEMRRIARHFRFGNQEDAHEFLQYTVDAMQKACLNGSNKLDRHTQATTLVCQIFGGYLRS
RVKCLNCKGVSDTFDPYLDITLEIKAAQSVNKALEQFVKPEQLDGENSYKCSKCKKMVPA
SKRFTIHRSSNVLTLSLKRFANFTGGKIAKDVKYPEYLDIRPYMSQPNGEPIIYVLYAVL
VHTGFNCHAGHYFCYIKASNGLWYQMNDSIVSTSDIRSVLSQQAYVLFYIRSHDVKNGGE
LTHSTHSPGQSSPRPVISQRVVNNKQAASGFIGPQLPSHMIKNPPHLNGTGPLKEAPSSS
MSSPSGNSSVSRAGSVNASTSVQNWSVNRPSVIPEHPKKQKITISIHNKLPVRQGQSQPN
LHSSSLENPNKPVPSSTVTNSSAIQSTSSASTTAVSSKVTKQMTPSESCSKPVMNGKSKL
NSSVLVPYGAESSEESDEEAKGLGKENGLGTIESSSSSVQDAEDDEASPLELREPLALNG
ADGTDSDLQENGLSCDGASCQVPPALHSENPFSKANGLPGKLMPVPLPPLPEDKILETFK
LSNKVKGSTEETSTPGPEESPAEGPGAEMEAGSPSPDPREKLETLTNLSSKLKKALPPLD
PSVKSTKEEVSENILAKPEESLPSANTLCSSTKNTTGDDVLPKLSGPGDLMDDQSRPPQA
VPGAFIESPRASAAVETVGGSSPSPPVRSEGACEHELLVYISRDKCTDTEDPPRSTGTAV
EDLPSPQLDKMTENHSEGGPEQSNSEKCEENKVGQKIPDHSPVKEKISILRKVDRGHYRN
RRDRSSSGERARESRSKTEDHYHKKRHSYLRERAKQDRYRTEPCGGAQHHPCHSERLSPG
EYRSLGRYSHHHSRNRGGSDQDWSRYHHSESEHSWGREKYYPAKLRWDKCRYYHDRYAQY
TARETREWKPFHSARDYTKASQYGSRPSKDYYKGRKGYEPVAKGRERHHFSPRAAPHALL
PYPEKYPHEKIALVADDATCNLAERFHEHENGKSRKRRYDSMDDSDGHIEKKAWRGIQKE
PLEEPRAKKHKKSKKKKKSKDKHRSRDSRHQQDSDLSVACSDADLHRHKKKKKKKKRHSR
KSEDFVKDSEPHLPKAASHETVDRFRRLDGTLPLTDGLPLEGVGPFREKRKHLRMGSRDD
RCPLSECGQGKRRYLELRI
NT seq 4020 nt NT seq  +upstreamnt  +downstreamnt
atgaccatagttgacaaagcttctgaatcttcagacccatcaacctatcagaatcagcct
ggcagctctgaggcagtctcacctggagacatggatgcaggttctgccagctggggagct
gtgtcttcgctaaatgatgtttcaaatcacacactttctttaggaccagtacctggtgct
gtagtttattcaagttcatctgtacctgataaatcaaaaccatcaccacaaaaggatcaa
gccctaggtgatggcattgctcctccacaaaaagttcttttcccatctgagaagatttgt
cttaagtggcaacagactcatagagttggagccgggctccagaatttgggcaatacctgt
tttgccaatgcagcattgcagtgtttgacttacacaccacctcttgccaattacatgcta
tcacatgaacactccaagacatgtcatgcagaaggattttgtatgatgtgtacaatgcaa
gcacatatcacccaggcactcagtaatcctggggatgttatcaagccgatgtttgtcatt
aatgagatgcggcgtatagctaggcacttccgctttggaaaccaagaagatgcccatgaa
ttccttcaatacactgttgatgctatgcaaaaagcgtgcttgaatggcagcaataaatta
gacagacatacccaggctaccacacttgtttgtcagatttttggaggatacctaagatct
agagtcaagtgtttaaattgcaaaggtgtttcagatacgttcgatccatatcttgatata
acgttggagataaaggctgctcagagtgttaacaaggcattggagcagtttgtgaagccg
gaacagctcgatggggaaaactcttacaagtgcagcaagtgtaaaaagatggttccagct
tccaagaggttcactatacacagatcctctaatgttcttacgctttctttgaaacgtttt
gcaaattttactggtggaaaaattgctaaggatgtgaaatatcctgagtaccttgatatt
cgaccatacatgtctcaaccaaatggagaaccaattatctatgttctgtatgcagtgctg
gtacacactggctttaactgccatgctggccactacttctgctacatcaaagctagcaat
ggcctttggtatcaaatgaatgactccatcgtatctaccagtgatattagatcggtactc
agtcaacaagcttatgttctcttttatatcaggtcccacgatgtgaaaaatggaggtgaa
ctcactcattccactcacagccctggccagtcctcgccccgacccgtgatcagccagcgt
gttgtcaacaacaaacaggctgcgtcagggtttatcggaccacagctcccttctcacatg
ataaagaacccacctcacttaaatgggaccgggccattgaaagaagcgccgagtagttcc
atgtcaagtcctagtggaaattccagtgtcagccgggctggttctgttaatgcttcgact
tctgtgcaaaactggtccgttaacaggccttcagtgattccagaacatcccaagaaacaa
aaaatcacgatcagtattcacaacaagttacctgttcgccaaggccagtctcagcctaac
cttcacagcagttctttggagaacccaaacaagcctgttccctcttctaccgttaccaat
tcttctgcaatacagtctacctcgagcgcatctacgacagcagtttctagtaaagtcaca
aagcagatgaccccgagcgagtcctgttccaagcctgtgatgaatggcaagtccaagctg
aactccagcgtcctggtgccctatggtgctgagtcgtctgaagagtctgacgaggaggcg
aagggcctaggcaaggagaatggtctcggtacgattgagagctccagctcttctgtgcag
gatgcagaagacgatgaggcctctccgctcgagcttcgagaacctcttgctctaaatggt
gctgacggtacagacagtgacctgcaggaaaacggtctgtcctgtgatggtgccagttgc
caagtcccacctgcgctacactcagaaaatcccttttcgaaggcgaatggtctgcccggg
aagttgatgcctgttcctctgcctcctctcccagaagacaaaatcttagagaccttcaaa
ctcagcaacaaggttaaaggctcgacagaagaaaccagtacacctggaccagaggagagt
cctgcagagggtcccggtgcggaaatggaagctggcagcccctctccagatccccgtgag
aaactggagacactcacaaatcttagcagcaagctaaagaaggctctgccacccttagac
cccagcgtcaaatctaccaaagaagaagtctctgaaaacattttagcaaaacctgaggag
tctttgcctagtgccaacactctttgcagcagcaccaagaataccacgggggacgatgtg
ctccctaaactatctggccctggggatttgatggacgaccagagccgaccaccccaggct
gtacctggggcattcatagagagcccacgggcctcggctgctgtggagacagtggggggt
tcaagcccaagtcccccagtacgttccgagggggcctgtgagcatgaactcttagtctac
atcagtcgagacaagtgcacggacacggaggaccctcccaggagcacaggcacagctgtt
gaggacttgccctctccccaactagacaagatgacagaaaatcattcagaagggggcccc
gaacaaagtaacagtgagaaatgtgaagaaaataaggttggacagaagattccagatcat
tctccagttaaggaaaaaatcagtatcctcagaaaagttgatcgaggacattaccgcaac
cgtagagaccgttcctctagcggagaacgtgcacgggagagtaggagcaaaacagaggac
cactaccacaaaaagcgccactcatacctgcgggagcgggccaagcaggaccgctacagg
acggagccctgcggaggggcccagcaccacccctgtcacagtgagcggctcagccctggt
gagtaccgctccctgggccggtacagccaccaccactcccggaaccgaggtgggtcagac
caggactggagcagataccaccactcagagagtgagcactcctggggccgggagaaatac
tacccggccaaactgaggtgggacaagtgcaggtattaccacgacaggtacgcccagtac
acagccagggagacgcgtgagtggaagcccttccacagtgcccgtgactacaccaaggca
agccagtacggcagccggccctccaaggactactacaaggggaggaagggctacgagccg
gtcgccaagggcagggagcggcaccacttcagtccccgggccgccccccatgccctcctc
ccataccccgaaaagtacccccatgagaaaattgcacttgtagctgatgacgccacctgt
aacctcgccgagcggtttcatgagcacgagaacggcaagtcccggaagcggagatatgac
agcatggacgacagcgatggtcacattgagaagaaggcctggaggggcatacagaaggag
cccttggaagagcccagagcgaaaaagcacaaaaaatcaaagaagaaaaagaaatccaaa
gacaaacaccgcagccgggattccaggcatcagcaggattccgatctttcagtagcatgc
tctgatgccgacctccacagacacaaaaaaaagaagaagaaaaagaagaggcactccagg
aaatccgaggactttgttaaagactcagaaccgcacctccccaaggccgccagccatgag
actgttgaccgtttccggagactggacggcaccctccccctcaccgacgggctgcctctg
gaaggtgtcgggcctttccgtgagaagagaaaacacttaaggatgggaagcagggatgac
aggtgtcctctgtctgagtgtggccagggtaagaggagatacttggaattaagaatatag

DBGET integrated database retrieval system