KEGG   Canis familiaris (dog): 479777Help
Entry
479777            CDS       T01007                                 

Gene name
KAT8, MYST1
Definition
K(lysine) acetyltransferase 8
Orthology
K11308  
histone acetyltransferase MYST1 [EC:2.3.1.48]
Organism
cfa  Canis familiaris (dog)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6
AA seq 458 aa AA seqDB search
MAAQGAAARCGAATSGVAGEGDPGPGENAAVEGTAPSPGRVSPPTPARGEPEVTVEIGET
YLCRRPDSTWHSAEVIQSRVNDQEGREEFYVHYVGFNRRLDEWVDKNRLALTKTVKDAVQ
KNSEKYLSELAEQPERKITRNQKRKHDEINHVQKTYAEMDPTTAALEKEHEAITKVKYVD
KIHIGNYEIDAWYFSPFPEDYGKQPKLWLCEYCLKYMKFEKSYRFHLGQCQWRQPPGKEI
YRKSNISVYEVDGKDHKIYCQNLCLLAKLFLDHKTLYFDVEPFVFYILTEVDRQGAHIVG
YFSKEKESPDGNNVACILTLPPYQRRGYGKFLIAFSYELSKLESTVGSPEKPLSDLGKLS
YRSYWSWVLLEILRDFRGTLSIKDLSQMTSITQNDIISTLQSLNMVKYWKGQHVICVTPK
LVEEHLKSAQYKKPPITVDSVCLKWAPPKHKQVKLSKK
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atggcggcacagggagcagctgcgcggtgcggggcggcgacttcaggggttgcgggggag
ggcgatcccgggcccggggagaatgcggcggtcgaggggaccgccccgtccccgggccga
gtctctcccccgaccccggcgcgcggggagccggaagtcaccgtggagatcggagaaacg
tacctgtgccgacgcccggacagcacctggcattctgctgaagtgattcagtctcgagtg
aatgatcaggagggccgagaggaattctatgtacactatgtgggctttaaccggcgactg
gacgaatgggtagacaagaaccggctggcgctgaccaagacagtaaaagatgccgtgcag
aagaactcggagaagtacctgagtgagctggctgagcagcctgagcgcaagatcactcgc
aaccaaaagcgcaagcatgatgagatcaaccatgtgcagaagacctatgccgagatggac
cccaccactgcagccttggagaaggagcatgaggcgatcaccaaggtgaagtatgtggac
aagatccacatcgggaactacgaaatcgacgcctggtacttctccccattccccgaggac
tatgggaaacagcccaagctgtggctctgcgagtactgcctgaagtatatgaaatttgag
aagagctaccgcttccacttgggccagtgtcagtggcggcagcctccagggaaggagatc
tatcgcaagagcaacatttctgtgtatgaggtagacggcaaagaccacaagatttactgt
cagaacctgtgtctactggccaagctcttcctggaccacaagacgttgtacttcgatgtg
gagcccttcgtcttttacatcctgactgaggtggacaggcagggagcccacatcgttggc
tacttctccaaggagaaggagtctccagatgggaacaatgtggcctgcatcctgaccctg
cctccataccagcggcgcggctatggaaaatttctcattgccttcagctatgagctctcc
aagctcgagagcacagtcggctccccggagaagccgctgtctgacctgggcaagcttagc
taccgcagctactggtcttgggtcctgctggagattctgcgagatttccggggcacactg
tccatcaaggacctgagccagatgaccagcatcacccagaatgacatcatcagcaccctg
cagtccctcaacatggtcaagtactggaagggccagcatgtgatctgtgtcacacccaag
ctggtagaagaacacctcaaaagtgcccagtataaaaaaccacccatcacagtggactct
gtctgtctcaagtgggcaccccccaagcacaagcaagtcaaactctccaagaagtga

DBGET integrated database retrieval system