KEGG   Canis familiaris (dog): 479884Help
Entry
479884            CDS       T01007                                 

Gene name
SLC9A3R2, NHERF2
Definition
solute carrier family 9, subfamily A (NHE3, cation proton antiporter 3), member 3 regulator 2
Orthology
K13358  
Na(+)/H(+) exchange regulatory cofactor NHE-RF2
Organism
cfa  Canis familiaris (dog)
Pathway
Aldosterone-regulated sodium reabsorption
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Organismal Systems
  Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    479884 (SLC9A3R2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
6
AA seq 337 aa AA seqDB search
MAAAEPLRPRLCRLVRGEHGYGFHLHGEKGRRGQFIRRVEPGSPAEAAALRAGDRLVEVN
GVNVEGETHHQVVQRIKAVEGQTRLLVVDKETDEELRRRQLTCTEEMAQRGLPPTHDPWE
PKPDWARASNLSSEAGQKDVGGPPRELRPRLCHLRKGPQGYGFNLHSDKSRPGQYIRSVD
PGSPAAHSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAQEDEARLLVVDPETDEHFKRLR
VTPTEEHVEGPLLSPVTNGTSPAQLNGGSACSSRSDLPGLDKDTEDSNTWKRDPFQESGL
HLSPTAAEAKEKARATRVNKRAPQMDWNRKREIFSNF
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atggcagccgcggagccgctgcggccgcgcctgtgccgcctggtgcgcggggagcacggc
tacggcttccacctgcacggcgagaagggccgccgcggccagttcatccggcgcgtggag
cccggctcgccggccgaggcggctgcgctgcgcgcgggggaccggctggtcgaggtcaac
ggcgtcaacgtggagggcgagacgcaccaccaggtggtgcagagaatcaaggctgtggaa
ggacagactcggctgctggtggtggacaaagagacggacgaggagctccgccggcggcag
ctgacctgcacagaggagatggcccagcgagggcttccgcccacccatgacccctgggag
ccgaagccggactgggcacgtgcaagcaacctcagctccgaggcgggccagaaggatgtc
ggtgggccccccagggagctacgccctcggctctgccacctgagaaagggcccccaaggt
tacgggttcaacctgcacagtgacaagtcccggccgggacagtacatccgctccgtggac
ccaggctcgcctgccgctcactctggcctccgcgcccaggacagactcatcgaggtgaat
gggcagaatgtggaggggctgcgccacgcagaggtggtcgccagcatcaaggcgcaggag
gacgaggcccggctgctggtggtggaccccgaaacggatgagcacttcaagcggctacgg
gtcacacctactgaggagcacgtggaaggtccactgctatcaccagtcaccaatgggacc
agccctgcccagctgaacggtggctcagcgtgttcgtcccgaagtgatctgcctggctta
gacaaggacactgaggacagcaacacctggaagcgtgacccctttcaggagagcggcctc
cacctgagccccacggcggccgaagccaaggagaaggcgagagccacccgggtcaacaag
cgggcgccacagatggactggaaccggaagcgcgagatcttcagcaacttctga

DBGET integrated database retrieval system