KEGG   Canis familiaris (dog): 479984Help
Entry
479984            CDS       T01007                                 

Gene name
USP33
Definition
ubiquitin specific peptidase 33
Orthology
K11848  
ubiquitin carboxyl-terminal hydrolase 20/33 [EC:3.1.2.15]
Organism
cfa  Canis familiaris (dog)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
6
AA seq 912 aa AA seqDB search
MSAFRNHCPHLDSVGEITKEDLIQKSHGTCQDCKVRGPNLWACLENRCSYVGCGESQVDH
STIHSQETKHYLTVNLTTLRVWCYACSKEVFLDRKLGTQPPLPHVRPLHQTQENSVQDFK
IPSNTTLKTPLVAVFDDLDIEVEEEDELKARGLTGLKNIGNTCYMNAALQALSNCPPLTQ
FFLDCGGLARTDKKPAICKSYLKLMTELWHKSRPGSVVPTTLFQGIKTVNPTFRGYSQQD
AQEFLRCLMDLLHEELKEQVMEVEEDPQTITTEETMEEDKSQSDVDFQSCESCSSSDKAE
NENGSRTFSEDNNETTMLIQDDENNSEMSKDWQKEKMCNKINKVNSEGELDKDRDSLSEA
VDLNNQETVKVQIHSRASEYITDVHLNDLSTSQILPSNEGVNPRLSASPPKSGNLWPGLA
STHKKAQSASSPKRKKQHKKYRSVISDIFDGTIISSVQCLTCDRVSVTLETFQDLSLPIP
GKEDLAKLHSSSHPTSIVKAGSCGEAYAPQGWIAFFMEYVKRFVVSCVPSWFWGPIVTLQ
DCLAAFFARDELKGDNMYSCEKCKKLRNGVKFCKVQKFPEILCIHLKRFRHELMFSTKIS
THVSFPLEGLDLQPFLAKDSPAQIVTYDLLSVICHHGTASSGHYIAYCRNNLNNLWYEFD
DQSVTEVSESTVQNAEAYVLFYRKSSEEAQKERRRISNLLNIMEPSLLQFYISRQWLNKF
KTFAEPGPISNNDFLCIHGGVPPRKAGYIEDLVLMLPQNIWDNLYSRYGGGPAVNHLYIC
HTCQIEAEKIEKRRKTELEIFIRLNRAFQEEDSPATFYCISMQWFREWESFVKGKDGDPP
GPIDNTKIAVTKCGSVILRQGADSGQISEETWNFLQSIYGGGPEVIFRPPVVHVDPDILQ
SEEKIEVETRSL
NT seq 2739 nt NT seq  +upstreamnt  +downstreamnt
atgtcagcttttcgaaatcattgtccacatttggattcagttggtgaaataacgaaagaa
gacttaatacaaaaatctcatggtacttgtcaggattgtaaagtcagaggaccaaatctt
tgggcatgcctcgaaaatagatgttcatatgttggttgtggtgagtcacaagtagatcac
agcactatacactctcaggagacaaagcattatctaactgtgaaccttactactctccga
gtatggtgttacgcttgcagcaaagaagtatttttggataggaaattaggaactcagcca
cctttgcctcatgtaagaccacttcaccaaacacaagaaaacagtgtccaggattttaaa
atacctagtaatacaacattaaaaactcctctggttgctgtatttgatgatttggacata
gaagtagaagaagaagatgaacttaaggcaagaggccttacaggtttgaaaaatattgga
aatacttgttatatgaatgcagctttgcaggctctttctaactgcccacctttgacacag
ttttttcttgattgtggaggactagctcgaacagataagaaaccagccatttgtaaaagt
tatctcaaactgatgacagaactatggcataaaagcaggccaggatctgttgtgcctact
actctgtttcaaggaattaaaacagtaaatccaacatttagggggtattctcagcaggat
gctcaagaattccttcgatgtttaatggatctgcttcatgaagaattaaaagaacaggtc
atggaagttgaggaagatcctcaaactataacaactgaggaaaccatggaagaagacaag
agccagtcagatgtagattttcaatcctgtgaatcttgtagcagcagtgataaagcagaa
aatgaaaatggctctagaaccttttctgaagataataacgaaacaacaatgttgattcag
gatgatgagaacaattccgaaatgtcaaaagattggcaaaaagagaagatgtgcaataaa
attaataaagtaaattctgaaggagaattagataaagatagagactctttgtctgaagca
gtcgacttgaacaaccaggaaactgtcaaagtacagatacacagcagagcttcagaatat
attactgatgtccatttgaatgacctgtctacatcacagatcttaccatcaaatgaaggt
gttaatccacgattatcagcaagccctcctaaatcaggcaatttgtggccaggattggca
tccacacacaaaaaagctcaatctgcatcatctccaaagagaaaaaaacagcataagaaa
taccgaagtgttatttcagacatttttgatggaacaattattagttcagtgcagtgtctg
acttgtgacagggtatctgtaaccctcgagacctttcaagatctgtccttgccgattcct
ggcaaggaagaccttgctaagctgcattcatccagtcacccaacttctatagtcaaagca
ggatcatgtggcgaagcatatgctccccaagggtggatagcttttttcatggaatatgtg
aagaggtttgttgtctcatgtgttcctagctggttttggggtccaatagtaaccttgcaa
gattgtcttgctgccttcttcgccagagatgaactaaaaggtgacaatatgtacagttgt
gaaaaatgcaaaaagttaaggaatggagtaaagttttgtaaagtacaaaaatttcctgag
attttatgcatacatcttaaaagattcagacatgaactgatgttttccaccaaaatcagt
acccatgtttcatttccgctggaaggtctggatcttcagccatttcttgctaaagatagt
ccagctcaaattgttacttatgaccttctgtcagtcatttgtcatcatggaactgcaagt
agtggacactatattgcctactgccgaaataatttaaataatctctggtatgaattcgat
gatcaaagtgttactgaagtttcagaatctactgtacaaaatgcagaagcttatgttctt
ttttataggaaaagcagtgaagaggcacaaaaagagagacgaaggatatccaatttattg
aacataatggaaccaagtctccttcagttttatatttctcgacagtggctaaataaattt
aagacctttgctgaacctggccctatttcaaataatgattttctctgtattcatggaggt
gttcctccacgaaaagctggttatattgaagatctggttttgatgctgcctcagaacatt
tgggataacctatatagcaggtatggaggaggaccagctgtcaaccatctgtacatttgt
cacacttgccaaattgaggcggagaaaattgaaaaaagaagaaaaactgaattggaaatt
tttattcggctcaacagagcattccaagaggaggattctccagctactttttattgtatc
agtatgcagtggtttagagaatgggaaagctttgtaaagggtaaagatggagatcctcca
ggtcctattgataacactaaaattgcagtcactaaatgtggcagtgtgatactcaggcaa
ggagcagattctggtcagatttctgaagaaacatggaattttctacagtctatatatggt
ggagggcctgaagttatctttcgacctccagttgttcatgttgaccctgatatactacag
tcagaagaaaaaattgaagtagaaactcggtctttgtaa

DBGET integrated database retrieval system