KEGG   Canis familiaris (dog): 480010Help
Entry
480010            CDS       T01007                                 

Gene name
DYRK3
Definition
dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 3
Orthology
K08825  
dual-specificity tyrosine-(Y)-phosphorylation regulated kinase [EC:2.7.12.1]
Organism
cfa  Canis familiaris (dog)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
7
AA seq 587 aa AA seqDB search
MGGTARGPGRKDAGPPGAGLPPQQRRLGDGVYDTFMMIDETKCPPCSNVLCNPSELPLPR
RLNITAEQLTRDHTQRFLNGGEVKVEQLFQEFSTRRSDTLQSDGINDSEKCSPTVSQGKS
SDSLNAVKPSNSAKSSKVVPLTPEQALKQYKHHLTAYEKLEIINYPEIYFVGPNAKKRHG
VIGGPNNGGYDDADGAYIHVPRDHLAYRYEVLKIIGKGSFGQVARVYDHKLRQYVALKMV
RNEKRFHRQAAEEIRILEHLKKQDKTGSMNVIHMLESFTFRNHVCMAFELLSIDLYELIK
KNKFQGFSVQLVRKFAQSILQSLDALHKNKIIHCDLKPENILLKHHGRSATKVIDFGSSC
FEYQKLYTYIQSRFYRAPEIILGSRYSTPIDIWSFGCILAELLTGQPLFPGEDEGDQLAC
MMELLGMPPPKLLEQSKRAKYFINSKGLPRYCSVTTQADGRVVLVGGRSRRGKKRGPPGS
KDWVTALKGCDDYLFIEFLKRCLHWDPSARLTPAQALRHPWISKSVPRPLTIEKVSGKRV
VNPANAFQGLGSKLPPVVGIANKLKANLMSETNGGIPLCSVLPKLIS
NT seq 1764 nt NT seq  +upstreamnt  +downstreamnt
atgggaggcacggctcgcgggcccgggcggaaggatgcggggccgcccggagccgggctc
ccgccccagcagcggagattgggggatggtgtctatgataccttcatgatgatagatgaa
accaaatgcccaccctgttcaaatgtactctgcaatccttctgaactgcctctacccaga
agactaaatatcactgctgagcagttaacaagagatcacactcagcgcttcctgaatgga
ggtgaggtgaaagtggaacagctgtttcaagaatttagcaccagaagatccgatactctt
cagtcagatggcatcaacgactctgaaaaatgctctcctaccgtctctcagggtaaaagt
tcagatagcttgaatgcagtaaaacccagcaattcagccaaatcatccaaagtggtgcca
ctgactccagagcaagccctgaagcaatataaacaccacctcaccgcatatgagaagctg
gaaatcatcaattatccagaaatctactttgtgggcccaaatgccaaaaaaagacatgga
gtgatcggtggtcccaataacggggggtatgatgatgcagatggggcctatattcacgta
cctcgcgaccatctagcttatcgatatgaggtgctgaagattattggcaaggggagtttt
gggcaggtggcccgggtctacgatcacaaacttcgacagtatgtggccctaaagatggtg
cgcaatgaaaagcgcttccatcgtcaagccgctgaggagatccggatcttggagcatctt
aaaaagcaggacaaaaccggtagcatgaacgtcatccacatgctggaaagtttcacattc
cggaaccatgtttgcatggccttcgagttgctgagcatagacctttacgagctaattaaa
aaaaacaagtttcagggttttagcgtccagttagttcgcaagtttgctcaatccatcttg
caatccttggatgctctccacaaaaataagatcattcactgtgacctgaagccagaaaac
attctcctgaaacaccatgggcgcagcgcgaccaaggtcattgactttgggtccagctgc
ttcgaataccagaagctttacacgtatatccagtctcggttctacagagctccggagatc
atcctaggaagccgctacagcacacctatagacatatggagttttggctgcatccttgca
gaacttttaacaggacagcctctcttcccgggagaggatgaaggggaccagttggcctgt
atgatggagctgctagggatgccaccaccaaaacttctggaacaatccaaacgtgccaag
tacttcattaactctaagggcctacctcgctactgttctgtgactactcaggcagatggg
agagttgtgcttgtggggggtcgctcacgtaggggtaaaaagcggggccctccaggtagc
aaagactgggtgacagcactgaagggatgtgatgactacttgtttatagagtttctgaaa
aggtgtcttcactgggacccctctgcccgtttgaccccagctcaagcattaagacaccct
tggattagtaagtctgtgcccagacctcttaccattgaaaaggtgtcaggcaaacgggtg
gtaaatcctgcaaatgctttccagggactgggttccaagctgcctccagttgtcggaata
gccaataagctcaaagctaatttaatgtcagaaaccaacggtggtatacctctgtgcagt
gtactgccaaaactcattagctaa

DBGET integrated database retrieval system