KEGG   Canis familiaris (dog): 480034Help
Entry
480034            CDS       T01007                                 

Gene name
LAMC1
Definition
laminin, gamma 1 (formerly LAMB2)
Orthology
K05635  
laminin, gamma 1
Organism
cfa  Canis familiaris (dog)
Pathway
PI3K-Akt signaling pathway
Focal adhesion
ECM-receptor interaction
Prion diseases
Toxoplasmosis
Amoebiasis
Pathways in cancer
Small cell lung cancer
Class
Environmental Information Processing; Signal transduction; PI3K-Akt signaling pathway [PATH:cfa04151]
Environmental Information Processing; Signaling molecules and interaction; ECM-receptor interaction [PATH:cfa04512]
Cellular Processes; Cell communication; Focal adhesion [PATH:cfa04510]
Human Diseases; Cancers; Pathways in cancer [PATH:cfa05200]
Human Diseases; Cancers; Small cell lung cancer [PATH:cfa05222]
Human Diseases; Neurodegenerative diseases; Prion diseases [PATH:cfa05020]
Human Diseases; Infectious diseases; Amoebiasis [PATH:cfa05146]
Human Diseases; Infectious diseases; Toxoplasmosis [PATH:cfa05145]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
7
AA seq 1592 aa AA seqDB search
MAVALRLVSHLGVGCGAGQQYGRCKVSSWQKEHDVPFMVGTARPGGSSDHSCTTVVAVAP
GSTGVTGVTKSCHMXDAEQPHLQHGAAFLTDYNNQADTTWWQSQTMLAGVQYPNSINLTL
HLGKAFDITYVRLKFHTSRPESFAIYKRTREGGPWIPYQYYSGSCENTYSKANRGFIRTG
GDEQQALCTDEFSDISPLTGGNVAFSTLEGRPSAYNFDNSPVLQEWVTATDIRVTLNRLN
TFGDEVFNDPKVLKSYYYAISDFAVGGRCKCNGHASECVKNEFDKLVCNCKHNTYGVDCE
KCLPFFNDRPWRRATAESASECLPCDCNGRSQECYFDPELYRSTGHGGHCTNCQGNTDGA
NCERCRENFFRLVSHEACSPCHCSPVGSLSTQCDSYGRCSCKPGVMGEKCDRCQPGYHSL
TEAGCRPCSCNPAGSIDECNVETGRCVCKDNVEGFNCERCKPGFFNLESSNPRGCTPCFC
FGHSSVCTNAVGYSVYSITSTFQIDEDGWRVEQRDGSEASLEWSSERQDIAVISDSYFPR
YFIAPAKFLGKQVWSYGQNLSFSFRVDRRDTRLSAEDLVLEGAGLRVSVPLIAQGNSYPS
ETTMKYVFRLHEATDYPWRPPLSPFEFQKLLNNLTSIKIRGTYSERSAGYLDDVTLTSAR
PGPGVPATWVESCTCPVGYGGQFCEMCLSGYRRETPSLGPYSPCVLCTCNGHSETCDPET
GVCDCRDNTAGPHCEKCSDGYYGDSTTGSSSDCQPCPCPGGSSCAVVPKTQEVVCTNCPT
GTTGKRCELCDDGYFGDPLGRNGPVRLCRLCQCNDNIDPNAVGNCNRLTGECLKCIYNTA
GFYCDRCKDGFFGNPLAPNPADKCRACACNPYGTVKQQSSCNPVTGQCECLPHVTGRDCG
ACDPGFYNLQSGQGCERCDCHALGSTNGQCDIRTGQCECQPGITGQHCEHCEVNHFGFGP
EGCKPCDCHPEGSVSLQCKDDGRCECKQGFVGNRCDQCEENYFYNRSWPGCQECPACYRL
VKDKVADHRVKLQELENLIANLGTGEEVVTDQAFEDRLKEAEREVMDLLREAQDVKDVDQ
NLMDRLQRVNSTLSSQISRLQNIRNTIEETGNLAEQARARVESTEQLIEIASRELEKAKI
AVANVSITQPESTGDPNNMTLLAEEARKLAERHKQEADDIVRVAKTANDTSTEAYNLLLK
TLAGENQTALEIEELNRKYEQAKNISEDLEKQAARVHEEAKRAGDKAVEIYASVAQLTPV
DSEALENEANKIKKEAEDLDHLIDQKLKDYEDLREDMRGKELEVKKLLEKGKTEQQTADQ
LLARADAAKALAEEAAKKGRNTLQEANDILNNLKDFDRRVNDNKTAAEEALRRIPAINQT
IIEANEKTREAQLALGNAAADATEAKSKAHEAERIASAVQKNATSTKAEAERTFAEVTDL
DNEVNNMLKQLQEAEKELKKKQDDADQDMMMAGMASQAAQEAEINARKAKNSVTSLLSLI
NDLLEQLGQLDTVDLNKLNEIEGTLNKAKDEMKVSDLDRKVSDLENEARKQEAAIMDYNR
DIEEIMKDIRNLEDIKKTLPTGCFNTPSIEKP
NT seq 4779 nt NT seq  +upstreamnt  +downstreamnt
atggctgtggccctaaggttggtttcccacctaggagttggctgtggtgctggccagcag
tatggacgctgtaaagtcagttcctggcagaaggagcatgatgtgcccttcatggtgggg
acagcaaggccaggaggttcctcagaccattcctgcactacggttgttgctgttgctcct
ggaagtaccggggtaaccggggtcaccaagtcctgtcacatgtgagacgccgagcaaccc
cacctgcagcacggggcggccttcctgaccgactacaacaaccaggccgacaccacctgg
tggcagagccagaccatgctggccggggtgcagtaccccaactccatcaacctcacgctg
cacctgggaaaagctttcgacatcacgtatgtgcgcctcaagttccacaccagccgccca
gagagcttcgccatttacaagcgcacacgggaaggtgggccctggattccttaccagtac
tatagtggctcctgcgagaacacctactcaaaggcaaaccgcggcttcatcaggacagga
ggagatgagcagcaggccttgtgcaccgatgaattcagtgacatttcccctctaaccggg
ggcaacgtggccttttcgaccctagaaggaaggcccagtgcctacaactttgacaatagc
cctgtgctgcaggaatgggtaactgctactgacatcagagtaactctcaatcgcctgaac
acttttggagatgaagtgtttaacgaccccaaagttctcaagtcctattattacgcaatc
tctgattttgctgtgggtggtaggtgtaaatgcaacggacatgcaagtgagtgtgtgaag
aatgaatttgacaagttggtgtgtaattgcaaacataatacttatggggtagactgtgaa
aagtgtctgcctttcttcaacgaccggccgtggaggagggcaactgccgagagcgccagt
gaatgcctgccctgtgactgtaatggccgatcccaggagtgctactttgaccctgaacta
tatcggtccaccggccatggtggccactgtaccaactgccagggtaacacagatggtgcc
aactgtgagaggtgccgggagaatttcttccgccttgtgagccatgaagcctgctctcca
tgtcactgtagtcctgtaggctctctcagcacacagtgtgatagctacggcaggtgtagc
tgtaagccaggagtgatgggtgagaagtgtgaccgttgccagcctggataccattctctc
actgaggcaggatgtaggccatgctcttgtaatcctgctggcagcatagatgaatgtaat
gttgaaacaggaagatgtgtttgcaaagacaatgttgaaggcttcaattgtgagagatgc
aaacctggattttttaatctggaatcatctaatcctaggggttgcacaccctgcttctgc
tttgggcattcttctgtctgtacaaatgctgttggctacagtgtttattcgataacctct
acctttcagatcgatgaagacgggtggcgtgtggaacaaagggacggctctgaagcatca
ctggagtggtcctctgagaggcaggatattgccgtcatctcagatagttactttcctaga
tacttcattgctcctgcaaagttcttgggcaagcaggtgtggagttatggtcagaacctc
tccttctcctttcgagtggacaggcgagatactcggctctctgcagaagacctggtgctg
gagggagctggcctgagagtgtctgtgcccctgattgctcagggcaattcctatccaagt
gagaccactatgaaatatgtcttcaggctccatgaagcaacagattacccttggaggcct
cctcttagcccttttgaatttcagaagctcctaaacaatttgacctcaatcaaaatccgt
gggacctatagtgagagaagtgctggatatttggatgatgtcaccctaacaagcgctcgc
cctgggcccggggtgcctgccacctgggtggagtcctgcacctgtccggtgggatatgga
gggcagttttgtgagatgtgcctctcaggttacagaagagaaactccgagtctcgggcca
tacagtccatgcgtgctttgtacctgcaatggacacagtgagacctgtgaccctgagaca
ggtgtttgtgactgcagagacaatacagctggcccccactgtgagaagtgcagtgatggg
tactatggagattcaaccacgggctcctcctccgattgtcagccctgtccatgtcctggg
ggctccagttgtgccgtcgtccctaagacgcaggaggtggtgtgcaccaactgtcctact
ggcaccaccggtaaaaggtgtgagctctgtgatgatggctactttggagaccccctgggt
agaaatggccctgtgaggctttgccgcctctgccaatgcaatgacaacatcgaccccaat
gcagttggaaattgcaatcgcttgacaggagaatgcctgaaatgcatctataacactgct
ggcttctactgtgaccgatgcaaagacggattttttggaaatcccctggctcccaatcca
gcagacaaatgcagagcttgcgcttgcaatccctatggaaccgtaaagcagcagagcagc
tgtaaccctgtgacggggcagtgcgaatgtctgccccacgtgaccggccgggactgtgga
gcctgtgaccctggattctacaacctgcagagtgggcagggctgtgagaggtgcgactgc
catgcattgggttccaccaacgggcagtgtgacatccgcactggccagtgtgagtgccag
cctggcatcaccggtcagcactgtgagcactgtgaggtcaaccactttggatttggaccc
gaaggctgcaaaccctgtgactgtcatcctgagggatctgtttcactccagtgcaaagat
gatggtcgctgtgagtgcaaacagggttttgtgggaaatcgttgtgaccagtgtgaagag
aactatttctacaatcggtcttggcctggctgccaggagtgtccagcatgctaccggctg
gtaaaggataaggttgctgaccatcgagtgaaactccaggaattagagaatctcattgcg
aaccttggaactggggaagaggtggtgacagatcaagcctttgaggacagactgaaggag
gcagagagagaggttatggacctcctgcgagaggcccaggatgtcaaagatgtagaccag
aatttgatggaccgcctccagagagtgaatagcacgttatccagccaaattagccgttta
cagaatatccgtaataccattgaagagactggaaacttggccgagcaagcacgtgccagg
gtagaaagcacagagcagttgattgaaatcgcatcccgagaactggagaaagcaaagatt
gctgttgccaatgtgtcaatcactcagccagagtctacaggggacccaaacaacatgact
cttttggcagaagaagcacgaaagcttgctgaacgccataaacaagaagctgatgatatt
gtaagagtggcaaagacagctaatgatacatcaactgaggcatataatctgcttctgaaa
acactggcaggagaaaatcaaacagcacttgagattgaagagcttaatagaaagtatgaa
caagcaaagaacatctcagaggatctggagaagcaagctgcccgagtacatgaggaggcc
aagagggctggagataaagcggtggagatctatgccagcgttgcccagctgacacctgtg
gactcagaagcactagagaatgaggccaataaaataaagaaggaagctgaggatctggac
catctgattgaccagaaattgaaagattatgaggacctcagagaagacatgagagggaag
gaacttgaagtcaagaagcttctggagaagggaaagaccgaacaacagactgctgaccag
ctcctggcccgagcagatgctgccaaggctcttgcggaagaagctgctaaaaagggacga
aataccttacaggaagccaatgacattctcaacaacctgaaagatttcgataggcgagtg
aatgacaacaagactgctgcagaggaggctttacggaggattcctgccatcaaccagacc
atcattgaagccaatgaaaagacaagggaggcgcagctggcactgggcaatgcagctgca
gacgctactgaagccaagagcaaagcccatgaggcagagaggatcgccagcgctgtccag
aagaatgctaccagcaccaaggcagaagcagaaaggacttttgcagaagttacagacctg
gataatgaggtgaacaatatgttgaaacaactgcaggaagcagaaaaggagctgaagaaa
aaacaagatgatgctgaccaggatatgatgatggcagggatggcttcccaggctgctcag
gaagccgagatcaatgccagaaaggccaagaactccgttaccagcctcctcagcctgatt
aatgacctcctggagcagctggggcaactggacacagtggacctgaacaagctaaatgag
atcgaaggcaccctgaacaaagccaaagatgaaatgaaagtcagtgatctagacaggaaa
gtgtctgatctggagaatgaagccaggaagcaggaggctgccatcatggactataatcga
gatatcgaggagatcatgaaggacattcgcaacctggaagacatcaagaagaccctaccg
actggctgcttcaataccccgtccattgagaagccctag

DBGET integrated database retrieval system