KEGG   Canis familiaris (dog): 480034Help
Entry
480034            CDS       T01007                                 

Gene name
LAMC1
Definition
(RefSeq) laminin, gamma 1 (formerly LAMB2)
  KO
K05635  
laminin, gamma 1
Organism
cfa  Canis familiaris (dog)
Pathway
PI3K-Akt signaling pathway
Focal adhesion
ECM-receptor interaction
Prion diseases
Toxoplasmosis
Amoebiasis
Pathways in cancer
Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    480034 (LAMC1)
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    480034 (LAMC1)
 Cellular Processes
  Cellular community
   04510 Focal adhesion
    480034 (LAMC1)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    480034 (LAMC1)
   05222 Small cell lung cancer
    480034 (LAMC1)
  Neurodegenerative diseases
   05020 Prion diseases
    480034 (LAMC1)
  Infectious diseases
   05146 Amoebiasis
    480034 (LAMC1)
   05145 Toxoplasmosis
    480034 (LAMC1)
Cell adhesion molecules and their ligands [BR:cfa04516]
 1. Immunoglobulin Superfamily
  Neural system
   Enzymatic CD
    PTPRF, LAR; receptor-type tyrosine-protein phosphatase F [KO:K05695]
     Laminin-1 Extracellular matrix (ECM) components
      480034 (LAMC1)
  Others
   LU; Lutheran blood group glycoprotein [KO:K06578]
    Laminin-10 Extracellular matrix (ECM) components
     480034 (LAMC1)
    Laminin-11 Extracellular matrix (ECM) components
     480034 (LAMC1)
   MCAM, CD146; melanoma cell adhesion molecule [KO:K06534]
    Laminin-8 Extracellular matrix (ECM) components
     480034 (LAMC1)
   CXADR, CAR; coxsackievirus and adenovirus receptor [KO:K06788]
    Laminin-1 Extracellular matrix (ECM) components
     480034 (LAMC1)
 2. Integrin Family
  Beta1 integrins
   VLA-1
    ITGB1; integrin beta 1 [KO:K05719]
      480034 (LAMC1)
     Laminin-2 Extracellular matrix (ECM) components
      480034 (LAMC1)
   VLA-2
     Laminin-1 Extracellular matrix (ECM) components
      480034 (LAMC1)
   VLA-3
      480034 (LAMC1)
     Laminin-10 Extracellular matrix (ECM) components
      480034 (LAMC1)
     Laminin-11 Extracellular matrix (ECM) components
      480034 (LAMC1)
   VLA-6
     Laminin-1 Extracellular matrix (ECM) components
      480034 (LAMC1)
     Laminin-8 Extracellular matrix (ECM) components
      480034 (LAMC1)
   VLA-7
     Laminin-1 Extracellular matrix (ECM) components
      480034 (LAMC1)
  Beta4 integrins
   alpha 6 beta 4
    ITGB4; integrin beta 4 [KO:K06525]
     Laminin-1 Extracellular matrix (ECM) components
      480034 (LAMC1)
 7. Others
  DAG1; dystroglycan 1 [KO:K06265]
   Laminin-1 Extracellular matrix (ECM) components
    480034 (LAMC1)
   Laminin-2 Extracellular matrix (ECM) components
    480034 (LAMC1)
  APP; amyloid beta A4 protein [KO:K04520]
   Laminin-1 Extracellular matrix (ECM) components
    480034 (LAMC1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
7
AA seq 1487 aa AA seqDB search
MLAGVQYPNSINLTLHLGKAFDITYVRLKFHTSRPESFAIYKRTREGGPWIPYQYYSGSC
ENTYSKANRGFIRTGGDEQQALCTDEFSDISPLTGGNVAFSTLEGRPSAYNFDNSPVLQE
WVTATDIRVTLNRLNTFGDEVFNDPKVLKSYYYAISDFAVGGRCKCNGHASECVKNEFDK
LVCNCKHNTYGVDCEKCLPFFNDRPWRRATAESASECLPCDCNGRSQECYFDPELYRSTG
HGGHCTNCQGNTDGANCERCRENFFRLVSHEACSPCHCSPVGSLSTQCDSYGRCSCKPGV
MGEKCDRCQPGYHSLTEAGCRPCSCNPAGSIDECNVETGRCVCKDNVEGFNCERCKPGFF
NLESSNPRGCTPCFCFGHSSVCTNAVGYSVYSITSTFQIDEDGWRVEQRDGSEASLEWSS
ERQDIAVISDSYFPRYFIAPAKFLGKQVWSYGQNLSFSFRVDRRDTRLSAEDLVLEGAGL
RVSVPLIAQGNSYPSETTMKYVFRLHEATDYPWRPPLSPFEFQKLLNNLTSIKIRGTYSE
RSAGYLDDVTLTSARPGPGVPATWVESCTCPVGYGGQFCEMCLSGYRRETPSLGPYSPCV
LCTCNGHSETCDPETGVCDCRDNTAGPHCEKCSDGYYGDSTTGSSSDCQPCPCPGGSSCA
VVPKTQEVVCTNCPTGTTGKRCELCDDGYFGDPLGRNGPVRLCRLCQCNDNIDPNAVGNC
NRLTGECLKCIYNTAGFYCDRCKDGFFGNPLAPNPADKCRACACNPYGTVKQQSSCNPVT
GQCECLPHVTGRDCGACDPGFYNLQSGQGCERCDCHALGSTNGQCDIRTGQCECQPGITG
QHCEHCEVNHFGFGPEGCKPCDCHPEGSVSLQCKDDGRCECKQGFVGNRCDQCEENYFYN
RSWPGCQECPACYRLVKDKVADHRVKLQELENLIANLGTGEEVVTDQAFEDRLKEAEREV
MDLLREAQDVKDVDQNLMDRLQRVNSTLSSQISRLQNIRNTIEETGNLAEQARARVESTE
QLIEIASRELEKAKIAVANVSITQPESTGDPNNMTLLAEEARKLAERHKQEADDIVRVAK
TANDTSTEAYNLLLKTLAGENQTALEIEELNRKYEQAKNISEDLEKQAARVHEEAKRAGD
KAVEIYASVAQLTPVDSEALENEANKIKKEAEDLDHLIDQKLKDYEDLREDMRGKELEVK
KLLEKGKTEQQTADQLLARADAAKALAEEAAKKGRNTLQEANDILNNLKDFDRRVNDNKT
AAEEALRRIPAINQTIIEANEKTREAQLALGNAAADATEAKSKAHEAERIASAVQKNATS
TKAEAERTFAEVTDLDNEVNNMLKQLQEAEKELKKKQDDADQDMMMAGMASQAAQEAEIN
ARKAKNSVTSLLSLINDLLEQLGQLDTVDLNKLNEIEGTLNKAKDEMKVSDLDRKVSDLE
NEARKQEAAIMDYNRDIEEIMKDIRNLEDIKKTLPTGCFNTPSIEKP
NT seq 4464 nt NT seq  +upstreamnt  +downstreamnt
atgctggccggggtgcagtaccccaactccatcaacctcacgctgcacctgggaaaagct
ttcgacatcacgtatgtgcgcctcaagttccacaccagccgcccagagagcttcgccatt
tacaagcgcacacgggaaggtgggccctggattccttaccagtactatagtggctcctgc
gagaacacctactcaaaggcaaaccgcggcttcatcaggacaggaggagatgagcagcag
gccttgtgcaccgatgaattcagtgacatttcccctctaaccgggggcaacgtggccttt
tcgaccctagaaggaaggcccagtgcctacaactttgacaatagccctgtgctgcaggaa
tgggtaactgctactgacatcagagtaactctcaatcgcctgaacacttttggagatgaa
gtgtttaacgaccccaaagttctcaagtcctattattacgcaatctctgattttgctgtg
ggtggtaggtgtaaatgcaacggacatgcaagtgagtgtgtgaagaatgaatttgacaag
ttggtgtgtaattgcaaacataatacttatggggtagactgtgaaaagtgtctgcctttc
ttcaacgaccggccgtggaggagggcaactgccgagagcgccagtgaatgcctgccctgt
gactgtaatggccgatcccaggagtgctactttgaccctgaactatatcggtccaccggc
catggtggccactgtaccaactgccagggtaacacagatggtgccaactgtgagaggtgc
cgggagaatttcttccgccttgtgagccatgaagcctgctctccatgtcactgtagtcct
gtaggctctctcagcacacagtgtgatagctacggcaggtgtagctgtaagccaggagtg
atgggtgagaagtgtgaccgttgccagcctggataccattctctcactgaggcaggatgt
aggccatgctcttgtaatcctgctggcagcatagatgaatgtaatgttgaaacaggaaga
tgtgtttgcaaagacaatgttgaaggcttcaattgtgagagatgcaaacctggatttttt
aatctggaatcatctaatcctaggggttgcacaccctgcttctgctttgggcattcttct
gtctgtacaaatgctgttggctacagtgtttattcgataacctctacctttcagatcgat
gaagacgggtggcgtgtggaacaaagggacggctctgaagcatcactggagtggtcctct
gagaggcaggatattgccgtcatctcagatagttactttcctagatacttcattgctcct
gcaaagttcttgggcaagcaggtgtggagttatggtcagaacctctccttctcctttcga
gtggacaggcgagatactcggctctctgcagaagacctggtgctggagggagctggcctg
agagtgtctgtgcccctgattgctcagggcaattcctatccaagtgagaccactatgaaa
tatgtcttcaggctccatgaagcaacagattacccttggaggcctcctcttagccctttt
gaatttcagaagctcctaaacaatttgacctcaatcaaaatccgtgggacctatagtgag
agaagtgctggatatttggatgatgtcaccctaacaagcgctcgccctgggcccggggtg
cctgccacctgggtggagtcctgcacctgtccggtgggatatggagggcagttttgtgag
atgtgcctctcaggttacagaagagaaactccgagtctcgggccatacagtccatgcgtg
ctttgtacctgcaatggacacagtgagacctgtgaccctgagacaggtgtttgtgactgc
agagacaatacagctggcccccactgtgagaagtgcagtgatgggtactatggagattca
accacgggctcctcctccgattgtcagccctgtccatgtcctgggggctccagttgtgcc
gtcgtccctaagacgcaggaggtggtgtgcaccaactgtcctactggcaccaccggtaaa
aggtgtgagctctgtgatgatggctactttggagaccccctgggtagaaatggccctgtg
aggctttgccgcctctgccaatgcaatgacaacatcgaccccaatgcagttggaaattgc
aatcgcttgacaggagaatgcctgaaatgcatctataacactgctggcttctactgtgac
cgatgcaaagacggattttttggaaatcccctggctcccaatccagcagacaaatgcaga
gcttgcgcttgcaatccctatggaaccgtaaagcagcagagcagctgtaaccctgtgacg
gggcagtgcgaatgtctgccccacgtgaccggccgggactgtggagcctgtgaccctgga
ttctacaacctgcagagtgggcagggctgtgagaggtgcgactgccatgcattgggttcc
accaacgggcagtgtgacatccgcactggccagtgtgagtgccagcctggcatcaccggt
cagcactgtgagcactgtgaggtcaaccactttggatttggacccgaaggctgcaaaccc
tgtgactgtcatcctgagggatctgtttcactccagtgcaaagatgatggtcgctgtgag
tgcaaacagggttttgtgggaaatcgttgtgaccagtgtgaagagaactatttctacaat
cggtcttggcctggctgccaggagtgtccagcatgctaccggctggtaaaggataaggtt
gctgaccatcgagtgaaactccaggaattagagaatctcattgcgaaccttggaactggg
gaagaggtggtgacagatcaagcctttgaggacagactgaaggaggcagagagagaggtt
atggacctcctgcgagaggcccaggatgtcaaagatgtagaccagaatttgatggaccgc
ctccagagagtgaatagcacgttatccagccaaattagccgtttacagaatatccgtaat
accattgaagagactggaaacttggccgagcaagcacgtgccagggtagaaagcacagag
cagttgattgaaatcgcatcccgagaactggagaaagcaaagattgctgttgccaatgtg
tcaatcactcagccagagtctacaggggacccaaacaacatgactcttttggcagaagaa
gcacgaaagcttgctgaacgccataaacaagaagctgatgatattgtaagagtggcaaag
acagctaatgatacatcaactgaggcatataatctgcttctgaaaacactggcaggagaa
aatcaaacagcacttgagattgaagagcttaatagaaagtatgaacaagcaaagaacatc
tcagaggatctggagaagcaagctgcccgagtacatgaggaggccaagagggctggagat
aaagcggtggagatctatgccagcgttgcccagctgacacctgtggactcagaagcacta
gagaatgaggccaataaaataaagaaggaagctgaggatctggaccatctgattgaccag
aaattgaaagattatgaggacctcagagaagacatgagagggaaggaacttgaagtcaag
aagcttctggagaagggaaagaccgaacaacagactgctgaccagctcctggcccgagca
gatgctgccaaggctcttgcggaagaagctgctaaaaagggacgaaataccttacaggaa
gccaatgacattctcaacaacctgaaagatttcgataggcgagtgaatgacaacaagact
gctgcagaggaggctttacggaggattcctgccatcaaccagaccatcattgaagccaat
gaaaagacaagggaggcgcagctggcactgggcaatgcagctgcagacgctactgaagcc
aagagcaaagcccatgaggcagagaggatcgccagcgctgtccagaagaatgctaccagc
accaaggcagaagcagaaaggacttttgcagaagttacagacctggataatgaggtgaac
aatatgttgaaacaactgcaggaagcagaaaaggagctgaagaaaaaacaagatgatgct
gaccaggatatgatgatggcagggatggcttcccaggctgctcaggaagccgagatcaat
gccagaaaggccaagaactccgttaccagcctcctcagcctgattaatgacctcctggag
cagctggggcaactggacacagtggacctgaacaagctaaatgagatcgaaggcaccctg
aacaaagccaaagatgaaatgaaagtcagtgatctagacaggaaagtgtctgatctggag
aatgaagccaggaagcaggaggctgccatcatggactataatcgagatatcgaggagatc
atgaaggacattcgcaacctggaagacatcaagaagaccctaccgactggctgcttcaat
accccgtccattgagaagccctag

DBGET integrated database retrieval system