KEGG   Canis familiaris (dog): 480034Help
Entry
480034            CDS       T01007                                 

Gene name
LAMC1
Definition
(RefSeq) laminin subunit gamma 1
  KO
K05635  laminin, gamma 1
Organism
cfa  Canis familiaris (dog)
Pathway
cfa04151  PI3K-Akt signaling pathway
cfa04510  Focal adhesion
cfa04512  ECM-receptor interaction
cfa05020  Prion diseases
cfa05145  Toxoplasmosis
cfa05146  Amoebiasis
cfa05165  Human papillomavirus infection
cfa05200  Pathways in cancer
cfa05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    480034 (LAMC1)
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    480034 (LAMC1)
 Cellular Processes
  Cellular community - eukaryotes
   04510 Focal adhesion
    480034 (LAMC1)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    480034 (LAMC1)
   05222 Small cell lung cancer
    480034 (LAMC1)
  Neurodegenerative diseases
   05020 Prion diseases
    480034 (LAMC1)
  Infectious diseases
   05165 Human papillomavirus infection
    480034 (LAMC1)
   05146 Amoebiasis
    480034 (LAMC1)
   05145 Toxoplasmosis
    480034 (LAMC1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Laminin_EGF Laminin_N Laminin_B LOH1CR12
Motif
Other DBs
NCBI-GeneID: 480034
NCBI-ProteinID: XP_013970599
Ensembl: ENSCAFG00000013234
UniProt: F1PHK9
Position
7
AA seq 1487 aa AA seqDB search
MLAGVQYPNSINLTLHLGKAFDITYVRLKFHTSRPESFAIYKRTREGGPWIPYQYYSGSC
ENTYSKANRGFIRTGGDEQQALCTDEFSDISPLTGGNVAFSTLEGRPSAYNFDNSPVLQE
WVTATDIRVTLNRLNTFGDEVFNDPKVLKSYYYAISDFAVGGRCKCNGHASECVKNEFDK
LVCNCKHNTYGVDCEKCLPFFNDRPWRRATAESASECLPCDCNGRSQECYFDPELYRSTG
HGGHCTNCQGNTDGANCERCRENFFRLVSHEACSPCHCSPVGSLSTQCDSYGRCSCKPGV
MGEKCDRCQPGYHSLTEAGCRPCSCNPAGSIDECNVETGRCVCKDNVEGFNCERCKPGFF
NLESSNPRGCTPCFCFGHSSVCTNAVGYSVYSITSTFQIDEDGWRVEQRDGSEASLEWSS
ERQDIAVISDSYFPRYFIAPAKFLGKQVWSYGQNLSFSFRVDRRDTRLSAEDLVLEGAGL
RVSVPLIAQGNSYPSETTMKYVFRLHEATDYPWRPPLSPFEFQKLLNNLTSIKIRGTYSE
RSAGYLDDVTLTSARPGPGVPATWVESCTCPVGYGGQFCEMCLSGYRRETPSLGPYSPCV
LCTCNGHSETCDPETGVCDCRDNTAGPHCEKCSDGYYGDSTTGSSSDCQPCPCPGGSSCA
VVPKTQEVVCTNCPTGTTGKRCELCDDGYFGDPLGRNGPVRLCRLCQCNDNIDPNAVGNC
NRLTGECLKCIYNTAGFYCDRCKDGFFGNPLAPNPADKCRACACNPYGTVKQQSSCNPVT
GQCECLPHVTGRDCGACDPGFYNLQSGQGCERCDCHALGSTNGQCDIRTGQCECQPGITG
QHCEHCEVNHFGFGPEGCKPCDCHPEGSVSLQCKDDGRCECKQGFVGNRCDQCEENYFYN
RSWPGCQECPACYRLVKDKVADHRVKLQELENLIANLGTGEEVVTDQAFEDRLKEAEREV
MDLLREAQDVKDVDQNLMDRLQRVNSTLSSQISRLQNIRNTIEETGNLAEQARARVESTE
QLIEIASRELEKAKIAVANVSITQPESTGDPNNMTLLAEEARKLAERHKQEADDIVRVAK
TANDTSTEAYNLLLKTLAGENQTALEIEELNRKYEQAKNISEDLEKQAARVHEEAKRAGD
KAVEIYASVAQLTPVDSEALENEANKIKKEAEDLDHLIDQKLKDYEDLREDMRGKELEVK
KLLEKGKTEQQTADQLLARADAAKALAEEAAKKGRNTLQEANDILNNLKDFDRRVNDNKT
AAEEALRRIPAINQTIIEANEKTREAQLALGNAAADATEAKSKAHEAERIASAVQKNATS
TKAEAERTFAEVTDLDNEVNNMLKQLQEAEKELKKKQDDADQDMMMAGMASQAAQEAEIN
ARKAKNSVTSLLSLINDLLEQLGQLDTVDLNKLNEIEGTLNKAKDEMKVSDLDRKVSDLE
NEARKQEAAIMDYNRDIEEIMKDIRNLEDIKKTLPTGCFNTPSIEKP
NT seq 4464 nt NT seq  +upstreamnt  +downstreamnt
atgctggccggggtgcagtaccccaactccatcaacctcacgctgcacctgggaaaagct
ttcgacatcacgtatgtgcgcctcaagttccacaccagccgcccagagagcttcgccatt
tacaagcgcacacgggaaggtgggccctggattccttaccagtactatagtggctcctgc
gagaacacctactcaaaggcaaaccgcggcttcatcaggacaggaggagatgagcagcag
gccttgtgcaccgatgaattcagtgacatttcccctctaaccgggggcaacgtggccttt
tcgaccctagaaggaaggcccagtgcctacaactttgacaatagccctgtgctgcaggaa
tgggtaactgctactgacatcagagtaactctcaatcgcctgaacacttttggagatgaa
gtgtttaacgaccccaaagttctcaagtcctattattacgcaatctctgattttgctgtg
ggtggtaggtgtaaatgcaacggacatgcaagtgagtgtgtgaagaatgaatttgacaag
ttggtgtgtaattgcaaacataatacttatggggtagactgtgaaaagtgtctgcctttc
ttcaacgaccggccgtggaggagggcaactgccgagagcgccagtgaatgcctgccctgt
gactgtaatggccgatcccaggagtgctactttgaccctgaactatatcggtccaccggc
catggtggccactgtaccaactgccagggtaacacagatggtgccaactgtgagaggtgc
cgggagaatttcttccgccttgtgagccatgaagcctgctctccatgtcactgtagtcct
gtaggctctctcagcacacagtgtgatagctacggcaggtgtagctgtaagccaggagtg
atgggtgagaagtgtgaccgttgccagcctggataccattctctcactgaggcaggatgt
aggccatgctcttgtaatcctgctggcagcatagatgaatgtaatgttgaaacaggaaga
tgtgtttgcaaagacaatgttgaaggcttcaattgtgagagatgcaaacctggatttttt
aatctggaatcatctaatcctaggggttgcacaccctgcttctgctttgggcattcttct
gtctgtacaaatgctgttggctacagtgtttattcgataacctctacctttcagatcgat
gaagacgggtggcgtgtggaacaaagggacggctctgaagcatcactggagtggtcctct
gagaggcaggatattgccgtcatctcagatagttactttcctagatacttcattgctcct
gcaaagttcttgggcaagcaggtgtggagttatggtcagaacctctccttctcctttcga
gtggacaggcgagatactcggctctctgcagaagacctggtgctggagggagctggcctg
agagtgtctgtgcccctgattgctcagggcaattcctatccaagtgagaccactatgaaa
tatgtcttcaggctccatgaagcaacagattacccttggaggcctcctcttagccctttt
gaatttcagaagctcctaaacaatttgacctcaatcaaaatccgtgggacctatagtgag
agaagtgctggatatttggatgatgtcaccctaacaagcgctcgccctgggcccggggtg
cctgccacctgggtggagtcctgcacctgtccggtgggatatggagggcagttttgtgag
atgtgcctctcaggttacagaagagaaactccgagtctcgggccatacagtccatgcgtg
ctttgtacctgcaatggacacagtgagacctgtgaccctgagacaggtgtttgtgactgc
agagacaatacagctggcccccactgtgagaagtgcagtgatgggtactatggagattca
accacgggctcctcctccgattgtcagccctgtccatgtcctgggggctccagttgtgcc
gtcgtccctaagacgcaggaggtggtgtgcaccaactgtcctactggcaccaccggtaaa
aggtgtgagctctgtgatgatggctactttggagaccccctgggtagaaatggccctgtg
aggctttgccgcctctgccaatgcaatgacaacatcgaccccaatgcagttggaaattgc
aatcgcttgacaggagaatgcctgaaatgcatctataacactgctggcttctactgtgac
cgatgcaaagacggattttttggaaatcccctggctcccaatccagcagacaaatgcaga
gcttgcgcttgcaatccctatggaaccgtaaagcagcagagcagctgtaaccctgtgacg
gggcagtgcgaatgtctgccccacgtgaccggccgggactgtggagcctgtgaccctgga
ttctacaacctgcagagtgggcagggctgtgagaggtgcgactgccatgcattgggttcc
accaacgggcagtgtgacatccgcactggccagtgtgagtgccagcctggcatcaccggt
cagcactgtgagcactgtgaggtcaaccactttggatttggacccgaaggctgcaaaccc
tgtgactgtcatcctgagggatctgtttcactccagtgcaaagatgatggtcgctgtgag
tgcaaacagggttttgtgggaaatcgttgtgaccagtgtgaagagaactatttctacaat
cggtcttggcctggctgccaggagtgtccagcatgctaccggctggtaaaggataaggtt
gctgaccatcgagtgaaactccaggaattagagaatctcattgcgaaccttggaactggg
gaagaggtggtgacagatcaagcctttgaggacagactgaaggaggcagagagagaggtt
atggacctcctgcgagaggcccaggatgtcaaagatgtagaccagaatttgatggaccgc
ctccagagagtgaatagcacgttatccagccaaattagccgtttacagaatatccgtaat
accattgaagagactggaaacttggccgagcaagcacgtgccagggtagaaagcacagag
cagttgattgaaatcgcatcccgagaactggagaaagcaaagattgctgttgccaatgtg
tcaatcactcagccagagtctacaggggacccaaacaacatgactcttttggcagaagaa
gcacgaaagcttgctgaacgccataaacaagaagctgatgatattgtaagagtggcaaag
acagctaatgatacatcaactgaggcatataatctgcttctgaaaacactggcaggagaa
aatcaaacagcacttgagattgaagagcttaatagaaagtatgaacaagcaaagaacatc
tcagaggatctggagaagcaagctgcccgagtacatgaggaggccaagagggctggagat
aaagcggtggagatctatgccagcgttgcccagctgacacctgtggactcagaagcacta
gagaatgaggccaataaaataaagaaggaagctgaggatctggaccatctgattgaccag
aaattgaaagattatgaggacctcagagaagacatgagagggaaggaacttgaagtcaag
aagcttctggagaagggaaagaccgaacaacagactgctgaccagctcctggcccgagca
gatgctgccaaggctcttgcggaagaagctgctaaaaagggacgaaataccttacaggaa
gccaatgacattctcaacaacctgaaagatttcgataggcgagtgaatgacaacaagact
gctgcagaggaggctttacggaggattcctgccatcaaccagaccatcattgaagccaat
gaaaagacaagggaggcgcagctggcactgggcaatgcagctgcagacgctactgaagcc
aagagcaaagcccatgaggcagagaggatcgccagcgctgtccagaagaatgctaccagc
accaaggcagaagcagaaaggacttttgcagaagttacagacctggataatgaggtgaac
aatatgttgaaacaactgcaggaagcagaaaaggagctgaagaaaaaacaagatgatgct
gaccaggatatgatgatggcagggatggcttcccaggctgctcaggaagccgagatcaat
gccagaaaggccaagaactccgttaccagcctcctcagcctgattaatgacctcctggag
cagctggggcaactggacacagtggacctgaacaagctaaatgagatcgaaggcaccctg
aacaaagccaaagatgaaatgaaagtcagtgatctagacaggaaagtgtctgatctggag
aatgaagccaggaagcaggaggctgccatcatggactataatcgagatatcgaggagatc
atgaaggacattcgcaacctggaagacatcaagaagaccctaccgactggctgcttcaat
accccgtccattgagaagccctag

DBGET integrated database retrieval system