KEGG   Canis familiaris (dog): 480182Help
Entry
480182            CDS       T01007                                 

Gene name
USP14
Definition
ubiquitin specific peptidase 14 (tRNA-guanine transglycosylase)
Orthology
K11843  
ubiquitin carboxyl-terminal hydrolase 14 [EC:3.1.2.15]
Organism
cfa  Canis familiaris (dog)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7
AA seq 510 aa AA seqDB search
MRLVAPVLPPPPRLRLGRRRHSFIASLSLRRPCQAQPSCTAAAAAAASRAAMPLYSVTVK
WGKEKFEGVELNTDEPPMVFKAQLFALTGVQPARQKVMVKGGTLKDDDWGNLKIKNMELP
CGLTNLGNTCYMNATVQCIRSVPELKDALKRYAGALRASGEMASAQYITAALRDLFDSMD
KTSSSIPPIILLQFLHMAFPQFAEKGEQGQYLQQDANECWIQMMRVLQQKLEAIEDDSVK
ETDSSSASAVTPSKKKSLIDQFFGVEFETTMKCTESEEEEVTKGKENQLQLSCFINQEVK
YLFTGLKLRLQEEITKQSPTLQRNALYIKSSKISRLPAYLTIQMVRFFYKEKESVNAKVL
KDVKFPLMLDVYELCTPELQEKMVSFRSKFKDLEDKKVNQQPKTSDKKSSPQKEVKYEPF
SFADDIGSNNCGYYDLQAVLTHQGRSSSSGHYVSWVKRKQDEWIKFDDDKVSIVTPEDIL
RLSGGGDWHIAYVLLYGPRRVEIMEEESEQ
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atgagactcgtcgcacccgtgctgccgccaccaccgcgcctccgcctcggccgccgccgc
cacagcttcatcgcgtccctttcccttcgacgcccttgccaggcccagccttcctgcacc
gccgccgccgccgccgccgcctctcgagccgccatgccgctttattccgttaccgtgaaa
tggggaaaggaaaaatttgaaggtgtagaattgaacactgatgaacctccaatggtgttt
aaggctcagctttttgcactgactggagtccaaccggccagacagaaagttatggtgaaa
ggaggaacattgaaggatgatgattggggaaacctcaaaataaaaaatatggaattacca
tgtggattgacaaaccttggtaacacttgttacatgaatgctacagttcagtgtattcgt
tctgtgcctgaactcaaagatgcccttaaaaggtatgcaggtgccttgagagcttcaggg
gaaatggcttcagcacagtatattactgcagcccttagagatttgtttgattccatggat
aaaacttcttctagtattccacctattattctactgcagtttttgcacatggcttttcca
cagtttgcggagaagggtgaacaaggacaatatcttcaacaggatgctaatgaatgttgg
atacaaatgatgcgagtattgcaacagaaattggaagccatagaggatgattctgttaaa
gagacagattcttcatctgcatcagcagtgacaccatctaaaaagaaaagtttaattgat
cagttcttcggagttgagtttgaaactaccatgaaatgtacagaatccgaagaagaagag
gttactaaaggaaaggaaaatcagcttcagcttagctgttttatcaatcaagaagtcaag
tatctttttacaggacttaaattgcgactccaggaagaaataactaagcagtctccaaca
ttgcaaagaaatgctttatatatcaaatcttccaagatcagccgactacctgcttacttg
actattcagatggttcgatttttttataaagagaaggaatctgtgaatgctaaagttctt
aaggatgttaaatttcctcttatgttggatgtgtatgaactgtgtacaccagaacttcag
gagaaaatggtctcttttcgatcaaaatttaaggatctagaagataaaaaagtgaatcag
cagccaaagacaagtgacaaaaagagtagtccccagaaagaagttaaatatgagcctttc
tcttttgctgatgacattggctccaataactgtggatactatgacttacaagcagtgtta
acacatcaaggaaggtctagctcttcaggccattacgtatcatgggtgaaaaggaaacaa
gatgaatggattaagtttgatgatgataaggtcagcatcgtgacaccagaggatatcttg
cggctttctggtggtggagactggcatatagcatatgttttactctatgggcctcgcaga
gttgaaataatggaagaggaaagtgaacagtaa

DBGET integrated database retrieval system