KEGG   Canis familiaris (dog): 480356Help
Entry
480356            CDS       T01007                                 

Gene name
GPX2
Definition
glutathione peroxidase 2 (gastrointestinal) (EC:1.11.1.9)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
cfa  Canis familiaris (dog)
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Thyroid hormone synthesis
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:cfa00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:cfa00480]
Organismal Systems; Endocrine system; Thyroid hormone synthesis [PATH:cfa04918]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
8
AA seq 190 aa AA seqDB search
MAYIAKSFYDLSAISLDGEKVDFNTFRGRAVLIENVASLUGTTTRDFTQLNELQCRFPRR
LVVLGFPCNQFGHQENCQNEEILNSLKYVRPGGGFQPTFTLVQKCEVNGQNEHPVFAYLK
DKLPYPYDDPLSLMTDPKFIIWSPVRRSDVAWNFEKFLIGPEGEPFRRYSRTFPTINIEP
DIKRLLKVAI
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atggcttacatagccaagtccttctacgacctcagtgctatcagcctggatggggagaag
gtagatttcaatacgttccgaggcagggccgtgctgattgagaatgtggcctcgctctga
ggcacaaccacccgggacttcacccagctcaacgagctgcaatgccgctttcccaggcgc
ctggtggttcttggcttcccttgcaaccaatttggacatcaggagaactgtcagaatgag
gagatcctgaacagcctcaagtatgtccgccctgggggtggattccagcccacctttacc
cttgtccaaaagtgtgaggtgaatggtcagaacgagcatcctgtcttcgcctacctgaag
gacaagctcccctacccctatgatgaccccttatccctcatgaccgatcccaagttcatc
atttggagccccgtgcgccgttcagatgtggcctggaactttgagaagttcctcattggg
ccggagggggagcccttccgccgctacagccgcaccttccccaccatcaacattgagcct
gacatcaagcgcctcctcaaagttgccatctag

DBGET integrated database retrieval system