KEGG   Canis familiaris (dog): 480364Help
Entry
480364            CDS       T01007                                 

Gene name
ARG2
Definition
(RefSeq) arginase 2
  KO
K01476  arginase [EC:3.5.3.1]
Organism
cfa  Canis familiaris (dog)
Pathway
cfa00220  Arginine biosynthesis
cfa00330  Arginine and proline metabolism
cfa01100  Metabolic pathways
cfa01230  Biosynthesis of amino acids
cfa05146  Amoebiasis
Module
cfa_M00029  Urea cycle
cfa_M00134  Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    480364 (ARG2)
   00330 Arginine and proline metabolism
    480364 (ARG2)
 Human Diseases
  Infectious diseases
   05146 Amoebiasis
    480364 (ARG2)
Enzymes [BR:cfa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     480364 (ARG2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-GeneID: 480364
NCBI-ProteinID: NP_001138592
Ensembl: ENSCAFG00000016428
UniProt: E2R8N6
Position
8
AA seq 374 aa AA seqDB search
MSLGSSLSRLLRTRVHSVLTKSVHSVAVIGAPFSQGQKRKGVEYGPAAIREAGLMKRLSS
LGCQLKDFGDLSFTPVPKDDLYNNLIVNPRSVGLANQELAEVVSRAVSSGYSCVTMGGDH
SLAIGTISGHARHCPDLCVIWVDAHADINTPLTTSSGNLHGQPVSFLLRELQDKVSGLKR
KDFYEEWVPQLPGFSWIKPCISSPNIIYIGLRDVDPPEQTPSFLFHSFILKNYDIQYFSM
RDIDRLGIQKVMEQTFDLLIGKQRPIHLSFDIDAFDPTLAPATGTPVVGGLTYREGMYIT
EEIHNTGLLSALDLVEVNPQLAASEEEAKATAGLAVDVIASSFGQTREGGHIVYDHLPTP
SSPDESESEERVRI
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atgtcgctgggaagcagcctgtcgcgtctcctgcggacgcgagtgcactccgtcctgacg
aagtccgttcactcggtggctgtgatcggggccccgttctcgcagggacagaaaagaaag
ggtgtggaatatggtcctgctgccataagagaagctggcttgatgaaaagactctccagt
ttgggctgccagctaaaagattttggagatttgagttttactccagtccctaaagatgat
ctctacaacaacctaatagtgaatcctcgctcagtgggccttgccaaccaggaactggct
gaagtggttagtagagctgtgtcaagtggctatagctgtgtcacaatgggaggagaccac
agcctggcaattggtaccattagtggccacgcccggcactgcccagacctttgtgtgatc
tgggttgatgcccatgctgacatcaatacacccctcaccacttcatctggaaatctccat
ggacagccagtttcatttctcctcagagaactacaggacaaggtcagtgggctaaaacga
aaagatttctatgaagaatgggtaccacaactcccaggattttcctggatcaaaccttgt
atctcttccccaaatatcatatatattggtctaagagatgtggaccctcctgaacagact
ccttcctttttatttcatagttttattttaaagaattatgatatccagtatttttccatg
agagacatagatcgacttggtattcagaaggtcatggaacagacatttgatctgctaatt
ggcaaacaaaggccaatccatctgagttttgatattgatgcatttgatcctaccctggct
ccagccacaggaactcctgtggtaggaggactgacctatcgagaaggcatgtatattact
gaggaaatacacaatacagggttgctgtcagcactggatcttgttgaagtcaatcctcag
ttggctgcttcagaggaagaggccaaggctacagctggcttggcagtggatgtgattgct
tcaagttttggtcagacaagggagggagggcacattgtttatgaccatcttcctactccc
agttcaccagatgaatcagaaagtgaagaacgtgtgagaatttag

DBGET integrated database retrieval system