KEGG   Canis familiaris (dog): 480364Help
Entry
480364            CDS       T01007                                 

Gene name
ARG2
Definition
(RefSeq) arginase 2 (EC:3.5.3.1)
  KO
K01476  
arginase [EC:3.5.3.1]
Organism
cfa  Canis familiaris (dog)
Pathway
Arginine biosynthesis
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Amoebiasis
Module
Urea cycle
Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    480364 (ARG2)
  Amino acid metabolism
   00220 Arginine biosynthesis
    480364 (ARG2)
   00330 Arginine and proline metabolism
    480364 (ARG2)
 Human Diseases
  Infectious diseases
   05146 Amoebiasis
    480364 (ARG2)
Enzymes [BR:cfa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     480364 (ARG2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
8
AA seq 374 aa AA seqDB search
MSLGSSLSRLLRTRVHSVLTKSVHSVAVIGAPFSQGQKRKGVEYGPAAIREAGLMKRLSS
LGCQLKDFGDLSFTPVPKDDLYNNLIVNPRSVGLANQELAEVVSRAVSSGYSCVTMGGDH
SLAIGTISGHARHCPDLCVIWVDAHADINTPLTTSSGNLHGQPVSFLLRELQDKVSGLKR
KDFYEEWVPQLPGFSWIKPCISSPNIIYIGLRDVDPPEQTPSFLFHSFILKNYDIQYFSM
RDIDRLGIQKVMEQTFDLLIGKQRPIHLSFDIDAFDPTLAPATGTPVVGGLTYREGMYIT
EEIHNTGLLSALDLVEVNPQLAASEEEAKATAGLAVDVIASSFGQTREGGHIVYDHLPTP
SSPDESESEERVRI
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atgtcgctgggaagcagcctgtcgcgtctcctgcggacgcgagtgcactccgtcctgacg
aagtccgttcactcggtggctgtgatcggggccccgttctcgcagggacagaaaagaaag
ggtgtggaatatggtcctgctgccataagagaagctggcttgatgaaaagactctccagt
ttgggctgccagctaaaagattttggagatttgagttttactccagtccctaaagatgat
ctctacaacaacctaatagtgaatcctcgctcagtgggccttgccaaccaggaactggct
gaagtggttagtagagctgtgtcaagtggctatagctgtgtcacaatgggaggagaccac
agcctggcaattggtaccattagtggccacgcccggcactgcccagacctttgtgtgatc
tgggttgatgcccatgctgacatcaatacacccctcaccacttcatctggaaatctccat
ggacagccagtttcatttctcctcagagaactacaggacaaggtcagtgggctaaaacga
aaagatttctatgaagaatgggtaccacaactcccaggattttcctggatcaaaccttgt
atctcttccccaaatatcatatatattggtctaagagatgtggaccctcctgaacagact
ccttcctttttatttcatagttttattttaaagaattatgatatccagtatttttccatg
agagacatagatcgacttggtattcagaaggtcatggaacagacatttgatctgctaatt
ggcaaacaaaggccaatccatctgagttttgatattgatgcatttgatcctaccctggct
ccagccacaggaactcctgtggtaggaggactgacctatcgagaaggcatgtatattact
gaggaaatacacaatacagggttgctgtcagcactggatcttgttgaagtcaatcctcag
ttggctgcttcagaggaagaggccaaggctacagctggcttggcagtggatgtgattgct
tcaagttttggtcagacaagggagggagggcacattgtttatgaccatcttcctactccc
agttcaccagatgaatcagaaagtgaagaacgtgtgagaatttag

DBGET integrated database retrieval system