KEGG   Canis familiaris (dog): 480364Help
Entry
480364            CDS       T01007                                 

Gene name
ARG2
Definition
arginase, type II (EC:3.5.3.1)
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
cfa  Canis familiaris (dog)
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Amoebiasis
Module
Urea cycle
Polyamine biosynthesis, arginine => ornithine => putrescine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:cfa01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:cfa00330]
Human Diseases; Infectious diseases; Amoebiasis [PATH:cfa05146]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
8
AA seq 374 aa AA seqDB search
MSLGSSLSRLLRTRVHSVLTKSVHSVAVIGAPFSQGQKRKGVEYGPAAIREAGLMKRLSS
LGCQLKDFGDLSFTPVPKDDLYNNLIVNPRSVGLANQELAEVVSRAVSSGYSCVTMGGDH
SLAIGTISGHARHCPDLCVIWVDAHADINTPLTTSSGNLHGQPVSFLLRELQDKVSGLKR
KDFYEEWVPQLPGFSWIKPCISSPNIIYIGLRDVDPPEQTPSFLFHSFILKNYDIQYFSM
RDIDRLGIQKVMEQTFDLLIGKQRPIHLSFDIDAFDPTLAPATGTPVVGGLTYREGMYIT
EEIHNTGLLSALDLVEVNPQLAASEEEAKATAGLAVDVIASSFGQTREGGHIVYDHLPTP
SSPDESESEERVRI
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atgtcgctgggaagcagcctgtcgcgtctcctgcggacgcgagtgcactccgtcctgacg
aagtccgttcactcggtggctgtgatcggggccccgttctcgcagggacagaaaagaaag
ggtgtggaatatggtcctgctgccataagagaagctggcttgatgaaaagactctccagt
ttgggctgccagctaaaagattttggagatttgagttttactccagtccctaaagatgat
ctctacaacaacctaatagtgaatcctcgctcagtgggccttgccaaccaggaactggct
gaagtggttagtagagctgtgtcaagtggctatagctgtgtcacaatgggaggagaccac
agcctggcaattggtaccattagtggccacgcccggcactgcccagacctttgtgtgatc
tgggttgatgcccatgctgacatcaatacacccctcaccacttcatctggaaatctccat
ggacagccagtttcatttctcctcagagaactacaggacaaggtcagtgggctaaaacga
aaagatttctatgaagaatgggtaccacaactcccaggattttcctggatcaaaccttgt
atctcttccccaaatatcatatatattggtctaagagatgtggaccctcctgaacagact
ccttcctttttatttcatagttttattttaaagaattatgatatccagtatttttccatg
agagacatagatcgacttggtattcagaaggtcatggaacagacatttgatctgctaatt
ggcaaacaaaggccaatccatctgagttttgatattgatgcatttgatcctaccctggct
ccagccacaggaactcctgtggtaggaggactgacctatcgagaaggcatgtatattact
gaggaaatacacaatacagggttgctgtcagcactggatcttgttgaagtcaatcctcag
ttggctgcttcagaggaagaggccaaggctacagctggcttggcagtggatgtgattgct
tcaagttttggtcagacaagggagggagggcacattgtttatgaccatcttcctactccc
agttcaccagatgaatcagaaagtgaagaacgtgtgagaatttag

DBGET integrated database retrieval system