KEGG   Canis familiaris (dog): 480400Help
Entry
480400            CDS       T01007                                 

Gene name
POMT2
Definition
protein-O-mannosyltransferase 2
Orthology
K00728  
dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
cfa  Canis familiaris (dog)
Pathway
Other types of O-glycan biosynthesis
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    480400 (POMT2)
Enzymes [BR:cfa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.109  dolichyl-phosphate-mannose---protein mannosyltransferase
     480400 (POMT2)
Glycosyltransferases [BR:cfa01003]
 O-Glycan biosynthesis
  O-linked Man type (Man a1- Ser/Thr)
   480400 (POMT2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
8
AA seq 820 aa AA seqDB search
MLCATSRLLAAGTATAPPAQPRGRGPGARCRRRELHFPGHPELPPGDFLLGRLARPSVPA
GRRVALRRGRMPPAVGGGPAGSEPRPRRGRAGVEGARAVGPDVGAEPAARSPKRPARGSR
CTEAAGRWTLLTLVTLLSFATRFHRLDEPRHICRDETHFGKMGSYYINRTFFFDVHPPLG
KMLIGLAGYLSGYDGTFLFQKPGDKYEHHNYMGMRGFCAFLGSLLVPFAYLTVLELSKSF
PAALLTAALLTFDTGCLTLSQYILLDPILMFFIMAAMLSMVKYNSCANRPFSAPWWFWLS
LTGINLAGALGVKFVGLFIILQVGWNTISDLWHLFGDLSLSVVTVGKHLTARILCLIALP
LTLYTATYAIHFMVLNKSGPGDGFFSSAFQARLSGNNLHNASIPEHLAYGSVITVKNLRM
AIGYLHSHRHLYPEGIGARQQQVTTYLHKDYNNLWIIKKHNTNADPLDPSIPVEFVRHGD
IVRLEHKETSRNLHSHYHEAPLTRKHYQVTGYGINGTGDSNDFWRIEVINRKFGNRIKVL
RSRIRLIHLVTGCVLGSSGKVLPKWGWEQLEVTCTPYLKETLNSIWNVEDHINPKLPNIS
LDVLQPTFPEILLESHMVMIRGNNGLKPKDNEFTSKPWHWPINYQGLRFSGINDTDFRVY
LLGNPVIWWLNLLSIALYLLLGSIIAVAVQRGTHLPAEVEGLSQVLLQGGGQLLLGWMLH
YFPFFLMGRILYFHHYFPAMLFSSMLTGILWDTLLRLCAWSLASSFLARGVYMVGILSLL
LGTAYSFYLFHPLAYGMVGPLAQDPGSPMAGLRWLESWDF
NT seq 2463 nt NT seq  +upstreamnt  +downstreamnt
atgctctgcgccaccagccgcctcctggcggccggcacggccaccgcgccccccgcccag
cccagaggccggggccccggggcccgctgccggcgcagggaactacatttcccagggcac
cccgagctgcccccgggtgacttcttgctggggcggctcgcaagaccgagcgtgccggcg
ggccggcgggtggccctgaggaggggcaggatgccgccggcggtgggcggaggcccggca
gggtccgagccgcgtccccggcgggggcgcgctggggttgagggggccagggctgtgggc
ccggacgtgggcgccgagcctgcagcgcggagccccaaacggcctgctcggggctcgcgg
tgcaccgaggcagccggccggtggaccctgctgaccctggtgacgctgctgtccttcgcc
acccgcttccaccgcctggacgagccgcgccacatctgtagggatgagactcactttgga
aaaatgggaagctattatatcaaccgcacctttttctttgatgtgcacccacctctggga
aagatgctgataggtcttgctggctacctgagtgggtatgatggtacttttttgttccag
aagcctggggacaaatatgaacatcacaactacatgggaatgagaggattctgtgctttc
cttggttccttgctggtcccatttgcctatctcactgtgttggagctgtctaagtccttc
ccagcagcactactcaccgctgccctcctcacctttgatacaggatgcctcactctgtcc
cagtatatcctccttgaccccatcctgatgttcttcatcatggctgccatgctgagcatg
gtcaagtacaactcctgtgccaacaggcccttctctgccccctggtggttctggctcagc
ctgactggcattaatctggctggtgctttaggggtcaagtttgttggcctctttatcatc
ctgcaagtggggtggaacaccatttcagacctttggcacctgtttggagacctcagtctt
tcagtggtgactgtgggaaagcacctgactgctcgcatactgtgcctcatagcactgccc
ctgactctctacacggccacttatgccattcacttcatggtgctgaacaaaagtggtcct
ggcgatggcttcttcagttctgccttccaggcccggctttcaggcaacaaccttcacaat
gcttccatccccgaacatctggcctatggctctgtgatcactgtgaagaacctgcggatg
gccattggctatctccactcccacaggcacctctaccccgagggcattggcgcccgccag
cagcaggtcaccacctatttgcacaaggactacaacaacctgtggattattaagaaacat
aatacaaatgcagatcccttggatccttcaatcccagtggagtttgtacgacatggagac
atcgttcggctagaacacaaagagacttctcggaacctacacagtcactatcatgaggcc
cccctgacccggaagcactatcaggtcactggctatggcataaacgggacaggagactca
aatgatttctggcggattgaggttataaacagaaaatttggaaaccggatcaaggtgctg
agaagtcgaattcgccttatccatctggtcacaggttgtgtcctgggctcctcgggaaag
gtcctgcccaagtggggctgggaacagttggaagttacttgtaccccatacctgaaggaa
accctcaactctatctggaatgtggaagaccatatcaatcccaaattgccaaacatcagc
ttggatgtgctacagcccacttttcctgaaatcttgctggaatcccacatggtgatgatc
cgggggaacaatggtctcaaacccaaggacaatgagttcacgtccaaaccctggcactgg
cctatcaactatcagggcctgcgtttctcagggatcaatgatacagacttccgtgtgtat
ctcctcggcaacccggtgatttggtggctgaatctgttgagcattgccctctacctcctc
ttgggcagcatcattgctgtagctgtgcaaagagggacccacctgcctgcggaggttgaa
gggctgtcccaggtcctgctgcaaggaggcggtcagctcctgctcggctggatgctccat
tacttcccattcttcctgatgggccggatcctctacttccaccactacttcccagccatg
ctcttctccagcatgttgacaggaattctgtgggatactctcctgcggctctgtgcctgg
agtctggcctcttctttcctggccaggggtgtatatatggtgggaatcctgagcctgctc
ctgggaactgcctacagcttctacctcttccaccctctggcttatgggatggttggtccc
cttgcccaggaccccggaagtcccatggcaggactaaggtggcttgaatcatgggacttt
tga

DBGET integrated database retrieval system