KEGG   Canis familiaris (dog): 480454Help
Entry
480454            CDS       T01007                                 

Gene name
MAP2K6
Definition
mitogen-activated protein kinase kinase 6
Orthology
K04433  
mitogen-activated protein kinase kinase 6 [EC:2.7.12.2]
Organism
cfa  Canis familiaris (dog)
Pathway
MAPK signaling pathway
Rap1 signaling pathway
Osteoclast differentiation
Toll-like receptor signaling pathway
Fc epsilon RI signaling pathway
TNF signaling pathway
Inflammatory mediator regulation of TRP channels
GnRH signaling pathway
Amyotrophic lateral sclerosis (ALS)
Toxoplasmosis
Influenza A
Epstein-Barr virus infection
Class
Environmental Information Processing; Signal transduction; Rap1 signaling pathway [PATH:cfa04015]
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:cfa04010]
Environmental Information Processing; Signal transduction; TNF signaling pathway [PATH:cfa04668]
Organismal Systems; Immune system; Toll-like receptor signaling pathway [PATH:cfa04620]
Organismal Systems; Immune system; Fc epsilon RI signaling pathway [PATH:cfa04664]
Organismal Systems; Endocrine system; GnRH signaling pathway [PATH:cfa04912]
Organismal Systems; Sensory system; Inflammatory mediator regulation of TRP channels [PATH:cfa04750]
Organismal Systems; Development; Osteoclast differentiation [PATH:cfa04380]
Human Diseases; Neurodegenerative diseases; Amyotrophic lateral sclerosis (ALS) [PATH:cfa05014]
Human Diseases; Infectious diseases; Influenza A [PATH:cfa05164]
Human Diseases; Infectious diseases; Epstein-Barr virus infection [PATH:cfa05169]
Human Diseases; Infectious diseases; Toxoplasmosis [PATH:cfa05145]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
9
AA seq 334 aa AA seqDB search
MSFPVGRKRNPGLKIPKEAFEQPQTSSTPPRDLDSKACISIGNQNFEVKADDLEPIMELG
RGAYGVVEKMRHVPSGQIMAVKRIRATVNSQEQKRLLMDLDISMRTVDCLFTVTFYGALF
REGDVWICMELMDTSLDKFYKQVIDKGQTIPEDILGKIAVSIVKALEHLHSKLSVIHRDV
KPSNVLINALGQVKMCDFGISGYLVDSVAKTIDAGCKPYMAPERINPELNQKGYSVKSDI
WSLGITMIELAILRFPYDSWGTPFQQLKQVVEEPSPQLPADKFSEEFVDFTSQCLKKNSK
ERPTYPELMQHPFFTLHESKATDVASFVKLILGD
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgtctttccccgtaggcaggaagcggaaccctggtcttaaaattccaaaagaagcattt
gaacaacctcagaccagttccacgccccctcgagacttagactctaaagcttgcatttca
attggaaatcagaactttgaggtgaaggcagatgacctggagcctataatggaactgggg
cgaggtgcgtacggggtggtggagaagatgcgacacgtgcccagcgggcagatcatggcg
gtgaagcggatccgggccacagtaaatagccaggagcagaaaaggctactgatggatttg
gatatttccatgaggacagtggactgtctttttacggtcaccttttatggcgcactcttc
cgggagggtgatgtttggatctgcatggagctcatggatacgtcgctagataagttctac
aaacaagtgattgataaaggccaaacgattccagaggacatcttagggaaaatagcagtt
tctattgtaaaagcgttagaacacttacacagtaagctctctgtcattcatcgagatgtc
aagccttccaacgtgctgatcaacgctctgggccaagtaaagatgtgcgattttggaatc
agtggctaccttgtagactctgtcgctaaaactattgatgcaggatgcaaaccgtacatg
gcccctgaaagaataaacccagagctcaatcagaagggatacagtgtgaagtctgacatt
tggagtctgggcatcacaatgattgagttggctatcctccggtttccctatgactcttgg
ggaactcccttccagcagctcaaacaggtggtagaggaaccctcgccacagctcccggcg
gacaaattctctgaagagtttgttgactttacctcacagtgcttgaagaagaattccaaa
gaacggccaacatatccagaacttatgcaacatccgtttttcaccctacacgaatccaaa
gcaacagacgtggcatcttttgtaaaactaattcttggagactaa

DBGET integrated database retrieval system