KEGG   Canis familiaris (dog): 480578Help
Entry
480578            CDS       T01007                                 

Gene name
CLTC
Definition
clathrin, heavy chain (Hc)
Orthology
K04646  
clathrin heavy chain
Organism
cfa  Canis familiaris (dog)
Pathway
Lysosome
Endocytosis
Synaptic vesicle cycle
Endocrine and other factor-regulated calcium reabsorption
Huntington's disease
Bacterial invasion of epithelial cells
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    480578 (CLTC)
   04142 Lysosome
    480578 (CLTC)
 Organismal Systems
  Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    480578 (CLTC)
  Nervous system
   04721 Synaptic vesicle cycle
    480578 (CLTC)
 Human Diseases
  Neurodegenerative diseases
   05016 Huntington's disease
    480578 (CLTC)
  Infectious diseases
   05100 Bacterial invasion of epithelial cells
    480578 (CLTC)
Exosome [BR:cfa04147]
 Exosomal proteins
  Proteins found in most exosomes
   480578 (CLTC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
9
AA seq 1682 aa AA seqDB search
MAQILPIRFQEHLQLQNLGINPANIGFSTLTMESDKFICIREKVGEQAQVVIIDMNDPSN
PIRRPISADSAIMNPASKVIALKAGKTLQIFNIEMKSKMKAHTMTDDVTFWKWISLNTVA
LVTDNAVYHWSMEGESQPVKMFDRHSSLAGCQIINYRTDAKQKWLLLTGISAQQNRVVGA
MQLYSVDRKVSQPIEGHAASFAQFKMEGNAEESTLFCFAVRGQAGGKLHIIEVGTPPTGN
QPFPKKAVDVFFPPEAQNDFPVAMQISEKHDVVFLITKYGYIHLYDLETGTCIYMNRISG
ETIFVTAPHEATAGIIGVNRKGQVLSVCVEEENIIPYITNVLQNPDLALRMAVRNNLAGA
EELFARKFNALFAQGNYSEAAKVAANAPKGILRTPDTIRRFQSVPAQPGQTSPLLQYFGI
LLDQGQLNKYESLELCRPVLQQGRKQLLEKWLKEDKLECSEELGDLVKSVDPTLALSVYL
RANVPNKVIQCFAETGQVQKIVLYAKKVGYTPDWIFLLRNVMRISPDQGQQFAQMLVQDE
EPLADITQIVDVFMEYNLIQQCTAFLLDALKNNRPSEGPLQTRLLEMNLMHAPQVADAIL
GNQMFTHYDRAHIAQLCEKAGLLQRALEHFTDLYDIKRAVVHTHLLNPEWLVNYFGSLSV
EDSLECLRAMLSANIRQNLQICVQVASKYHEQLSTQSLIELFESFKSFEGLFYFLGSIVN
FSQDPDVHFKYIQAACKTGQIKEVERICRESNCYDPERVKNFLKEAKLTDQLPLIIVCDR
FDFVHDLVLYLYRNNLQKYIEIYVQKVNPSRLPVVIGGLLDVDCSEDVIKNLILVVRGQF
STDELVAEVEKRNRLKLLLPWLEARIHEGCEEPATHNALAKIYIDSNNNPERFLRENPYY
DSRVVGKYCEKRDPHLACVAYERGQCDLELINVCNENSLFKSLSRYLVRRKDPELWGSVL
LESNPYRRPLIDQVVQTALSETQDPEEVSVTVKAFMTADLPNELIELLEKIVLDNSVFSE
HRNLQNLLILTAIKADRTRVMEYINRLDNYDAPDIANIAICNELFEEAFAIFRKFDVNTS
AVQVLIEHIGNLDRAYEFAERCNEPAVWSQLAKAQLQKGMVKEAIDSYIKADDPSSYMEV
VQAANTSGNWEELVKYLQMARKKARESYVETELIFALAKTNRLAELEEFINGPNNAHIQQ
VGDRCYDEKMYDAAKLLYNNVSNFGRLASTLVHLGEYQAAVDGARKANSTRTWKEVCFAC
VDGKEFRLAQMCGLHIVVHADELEELINYYQDRGYFEELITMLEAALGLERAHMGMFTEL
AILYSKFKPQKMREHLELFWSRVNIPKVLRAAEQAHLWAELVFLYDKYEEYDNAIITMMN
HPTDAWKEGQFKDIITKVANVELYYRAIQFYLEFKPLLLNDLLMVLSPRLDHTRAVNYFS
KVKQLPLVKPYLRSVQNHNNKSVNESLNNLFITEEDYQALRTSIDAYDNFDNISLAQRLE
KHELIEFRRIAAYLFKGNNRWKQSVELCKKDSLYKDAMQYASESKDTELAEELLQWFLQE
EKRECFGACLFTCYDLLRPDVVLETAWRHNIMDFAMPYFIQVMKEYLTKVDAIKEKVDKL
DASESLRKEEEQATETQPIVYGQPQLMLTAGPSVAVPPQAPFGYGYTAPPYGQPQPGFGY
SM
NT seq 5049 nt NT seq  +upstreamnt  +downstreamnt
atggcccagattctgccaattcgttttcaggagcatctccagctccagaacctgggtata
aacccagcaaacattggcttcagtaccctaactatggagtcagacaaattcatctgcatt
agagagaaagtaggagagcaggcccaggtggtaatcattgatatgaatgacccaagtaat
ccaattcgaagaccaatttcagcagacagcgccatcatgaatccagctagcaaagtaatt
gcattgaaagctgggaaaactcttcagatatttaacattgaaatgaaaagtaaaatgaag
gcccataccatgactgatgatgtcaccttctggaaatggatctctttgaatacggttgct
cttgttacggataatgcagtttatcactggagtatggaaggagaatctcagccagtgaaa
atgtttgatcgccattctagcctcgcagggtgccagattatcaactatcgtacagatgca
aagcaaaagtggttacttctgactggcatatctgcacagcaaaatcgtgtggtgggagct
atgcagttatattctgtagataggaaagtgtctcagcccattgaaggacatgcggctagc
tttgcccagtttaagatggaaggaaatgcagaagaatcaacgttattttgttttgcagta
cggggtcaagctggagggaagttacatatcattgaagttggcacaccacctacaggaaac
cagccctttccaaagaaggcagtggatgttttctttcctccagaagcacaaaatgacttc
cctgttgcaatgcagatcagtgaaaaacatgatgtagtattcttgattactaagtatggc
tatatccacctctatgatcttgagactggtacctgtatctacatgaacagaatcagtgga
gaaacaatctttgttactgcacctcatgaagccacagctggaataattggagtaaacaga
aagggacaagttctgtcagtatgtgtggaagaagaaaacataattccttatatcaccaat
gtcctacaaaatcctgatttggctttgagaatggctgtacgtaacaacttagctggtgct
gaagaactctttgcccggaaatttaatgctctttttgcccaggggaattactcagaggca
gcaaaggtggctgctaatgcaccaaagggaatccttcgtactccagacactatccgtcgg
ttccagagtgtcccagcccagccaggtcaaacttctcctctacttcagtactttggaatc
ctcttggatcaaggtcagctaaacaaatatgaatccttggaactatgtaggcctgtactt
cagcaagggcggaaacagcttttggagaaatggttaaaagaagataagctggaatgttct
gaagaactgggtgaccttgtgaaatctgtggaccctacattggcacttagtgtatacctg
cgggctaatgtcccaaataaagtcattcagtgttttgcagaaacaggtcaagtccagaag
attgttttatatgctaaaaaagttggatatactccagactggatatttctgctgagaaat
gtcatgcgtatcagtccagatcaaggacagcagtttgcccaaatgttagttcaagatgaa
gaacctcttgctgatatcacacagattgttgatgtctttatggaatacaatctaattcag
cagtgtactgcattcttgcttgatgccctaaagaataatcgcccatctgaaggtccttta
cagacacgattgcttgagatgaaccttatgcatgcacctcaagttgcagatgctattcta
gggaatcagatgtttacgcattatgaccgggctcatatcgctcagctgtgtgaaaaggct
ggtttactgcagcgtgcattagaacacttcactgatttatatgacataaagcgtgcggtt
gttcacactcatcttcttaaccctgagtggttagtgaattactttgggtccttatcagta
gaagactccctagaatgcctcagggccatgctgtctgccaacattcgtcagaatctgcag
atctgtgttcaggtggcttcgaagtatcatgaacaactgtcaactcaatctctaattgaa
ctttttgaatctttcaagagttttgaaggtctcttttattttctgggatccattgttaac
tttagtcaggacccagatgtgcactttaagtatattcaggcagcttgcaagactgggcag
atcaaagaagtagaaagaatctgcagagaaagcaactgctatgatcctgagcgagtcaag
aattttctcaaggaagcgaagctaacagatcagttaccacttatcattgtatgtgaccga
tttgactttgtccatgatttggtgctctatttatatagaaataatcttcaaaagtatata
gaaatatatgtacagaaggtaaatccaagtcgacttcctgtggttattggaggattgctt
gatgttgattgctctgaagatgttattaaaaatttgattcttgttgtaagaggtcaattc
tctactgatgagcttgttgctgaggttgaaaaaagaaacagattgaaactacttctgcct
tggctagaggccagaattcatgagggctgtgaggagcctgctactcacaacgcattagcc
aaaatctacatagacagtaataacaacccagagagatttcttcgtgaaaatccttattat
gacagtcgcgttgttggaaagtattgtgagaagagagatccacatctggcctgtgttgct
tatgaacgtggccaatgtgatctggaacttattaatgtttgcaatgagaattccctcttc
aaaagtctttcccgctatttggtacgccgaaaggatccagaattatggggtagtgtgctg
ctggaaagcaatccttacaggagacccctaattgaccaggttgtacagacagccttgtct
gagactcaggaccctgaagaagtatcagtaactgtcaaggcttttatgactgcagacctt
cctaatgaactcattgaactactggagaaaattgtccttgataactctgtatttagtgaa
cacaggaatctgcaaaatctcctcatcctcactgcaatcaaggctgaccgtacacgtgtt
atggagtatattaaccgcctggataattatgatgccccagatattgccaatattgccatc
tgcaatgagttgtttgaagaagcatttgccattttccggaaatttgatgttaatacttca
gcagttcaggtcttgattgaacatattggaaatttggatcgggcatatgagtttgctgaa
cgctgcaatgaacctgcagtttggagtcagcttgctaaagcccagttgcagaaaggaatg
gtgaaagaagccattgattcttatatcaaagcagatgatccttcatcctacatggaagtt
gttcaggctgccaacactagtggaaactgggaagaactggtgaagtacttgcagatggcc
cgtaagaaggctcgtgagtcctatgtggagacagaattgatatttgccttggctaaaaca
aaccgccttgcagagttagaagagttcatcaatgggccaaataatgctcatatccaacaa
gttggcgaccgttgttacgatgaaaaaatgtatgatgctgctaaactattgtacaataat
gtatccaattttggacgcttggcatctactctggttcacctgggtgaatatcaggcagct
gttgatggagctaggaaagctaacagtactcgaacatggaaagaggtctgctttgcctgt
gtagatggcaaggagttccgtcttgctcagatgtgtggacttcatattgtagtacatgca
gatgaattggaggaacttatcaactactatcaggatcgaggatactttgaagaactgata
accatgttggaagcagcattgggacttgagcgagctcatatgggaatgtttaccgaatta
gctattctgtattctaaatttaagccacaaaaaatgagggagcacctggagctattctgg
tccagagtgaatattcctaaggtgcttagagctgcagaacaagctcatctttgggcagaa
ttggtgtttttgtatgacaagtatgaagaatatgataatgccataattacaatgatgaat
catccaactgatgcgtggaaagaaggacagttcaaagatatcattaccaaggttgcaaat
gtggaactatattacagagcaatacagttctacttggaattcaagcctctgttgttaaat
gatttgctgatggtgctgtctccacggttggatcatactcgtgcagtcaattatttcagc
aaggttaaacagctaccattggtgaaaccatatttgcgttcagttcaaaaccacaataac
aaatctgtgaatgaatcactgaacaacctctttattacagaagaagattatcaggctctg
cgaacatcaatagatgcttatgacaattttgacaatatctcacttgctcagcgtttggaa
aaacatgaactcattgagttcagaagaattgctgcttatcttttcaaaggcaacaatcgc
tggaaacagagtgtagagctgtgcaaaaaagatagcctgtataaggatgcaatgcagtat
gcctctgaatctaaagatactgagttggctgaagaactcctacagtggtttttgcaggaa
gaaaaaagagagtgctttggagcttgtctttttacctgttatgatcttttaaggccagat
gttgtcctggaaactgcatggaggcacaatatcatggattttgccatgccctatttcatc
caggtcatgaaagaatacttgacaaaggttgatgcaataaaggaaaaggtggataaatta
gatgcttcagaatcactgagaaaagaagaagaacaagctacagagacacaacctattgtt
tatggtcagccccaattgatgctgacagcaggacccagtgttgcagtccctccccaggca
ccttttggctatggttatactgcaccaccctatgggcagccacagcctggctttgggtac
agcatgtga

DBGET integrated database retrieval system