KEGG   Canis familiaris (dog): 480590Help
Entry
480590            CDS       T01007                                 

Gene name
USP32
Definition
ubiquitin specific peptidase 32
Orthology
K11837  
ubiquitin carboxyl-terminal hydrolase 6/32 [EC:3.4.19.12]
Organism
cfa  Canis familiaris (dog)
Brite
Enzymes [BR:cfa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     480590 (USP32)
Peptidases [BR:cfa01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   480590 (USP32)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
9
AA seq 1631 aa AA seqDB search
MKEEEAHYMCSCFSPQFQLRSQPRTGTNCQAFTDVELKRLKDAFKRTCGLSYYMGQHCFI
REVLGDGVPPKVAEVIYCSFGGTSKGLHFNNLIVGLVLLTRGRDEEKAKYIFSLFASESG
NYVVREEMERMLHVVDGKVPDTLRKCFSEGEKVNYEKFRNWLLLNKDAFTFSRWLLSGGV
YVTLTDDSDTPTFYQTLAGVTHLEESDIIDLEKRYWLLKAQSRTGRFDLETFGPLVSPPI
RPSLSEGLFNAFDENRDNHIDFKEISCGLSACCRGPLAERQKFCFKVFDVDRDGVLSKVE
LRDMVVALLEVWKDNRTDDIPELHMDLSDIVEGILNAHDTTKMGHLTLEDYQIWSVKNVL
ANEFLNLLFQVCHIVLGLRPATPEEEGQIIRGWLERESRYGLQPGHNWFIISMQWWQQWK
EYVKYDASPVVIELSSVLNGGKYSIGTAVHCIEQSEDRIGGGSLSYVNTTEEKFSDNIST
ASEASETAGSGFLYSATPGADMCFARQHNTSDNNNQCLLGANGNILLHLNPQKPGAIDNQ
PLVTQEPVKATSLTLEGGRLKRTPQLIHGRDYEMVPEPVWRALYHWYGANLALPRPVIKN
SKTEIPELELFPRYLLFLRQQPATRTQQSNIWVNMGMISLRMFPQHLPRGNVPSPNAPLK
RVLAYTGCFSRMQTIKEIHEYLSQRLRIKEEDMRLWLYNSENYLTLLDDEDHRLEYLKIQ
DEQHLVIEVRNKDMSWPEEMSFIANSSKIDRHKVPTEKGATGLSNLGNTCFMNSSIQCVS
NTQPLTQYFISGRHLYELNRTNPIGMKGHMAKCYGDLVQELWSGTQKNVAPLKLRWTIAK
YAPRFNGFQQQDSQELLAFLLDGLHEDLNRVHEKPYVELKDSDGRPDWEVAAEAWDNHLR
RNRSIVVDLFHGQLRSQVRCKTCGHISVRFDPFNFLSLPLPMDSYMHLEITVIKLDGTTP
VRYGLRLNMDEKYTGLKKQLSDLCGLKSEQILLAEVHGSNIKNFPQDNQKVRLSVSGFLC
AFEIPIPGSPISASSPIQTDFSSSPSTNGMFTLTTNGDLPRPIFIPNGMPNTVVPCGTEK
NFTNGMVNGHMPSVPDNSFTGYIIAVHRKMMRTELYFLSSQKNRPSLFGMPLIVPCTVHT
RKKDLYDAVWIQVSRLASPLPPQEASNHAQDCDDSMGYQYPFTLRVVQKDGNSCAWCPWY
RFCRGCKIDCGEDRAFIGNAYIAVDWDPTALHLRYQTSQERVVDEHESVEQSRRAQAEPI
NLDSCLRAFTSEEELGENEMYYCSKCKTHCLATKKLDLWRLPPILIIHLKRFQFVNGRWI
KSQKIVKFPRENFDPSAFLVPRDPALCQRKPLTPQGDDLSEPRVPSGDMKKADAQNSTGE
EDVLLSKSPSSLSANIINSPKGSPSSSRKSGTSCPSSKNSSPNSSPRTLGRSKGRLRLPQ
IGSKNKLSSSKENLDASKENGAGQVCELADALSRGHMLGGSQTELVTPQDHEVALANGFL
YEHEACGNGYSNGQLENHSEEDSTDDQREDVHVKPIYNLYAISCHSGILGGGHYVTYAKN
PNSKWYCYNDSSCKELHPDEIDTDSAYILFYEQQGIDYAQFLPKIDGKKMADTSSMDEDF
ESDYKKYCVLQ
NT seq 4896 nt NT seq  +upstreamnt  +downstreamnt
atgaaggaagaggaagcacattacatgtgtagttgtttcagcccacagttccagctgagg
tctcagccaagaacaggcaccaattgtcaagcatttacagatgtagagctgaaacgactg
aaagatgccttcaagaggacatgtggactctcttattatatgggccagcactgcttcatc
agggaagtgcttggtgatggagtgcctccaaaagtggctgaggtgatttactgttctttt
ggtggaacatccaaaggactgcacttcaataacttaatagttggacttgtccttcttaca
agaggtagagatgaagagaaagcaaaatacatttttagtctttttgcaagtgaatctggg
aactatgttgtacgggaagaaatggaaagaatgctccatgtggtggatggtaaagtccca
gatacactcaggaagtgtttctcagagggtgaaaaggtaaactatgaaaagtttagaaat
tggcttcttctaaacaaagatgcttttaccttctctcgttggctactatctggaggtgtt
tatgtcaccctcactgatgatagtgatactcccactttctaccaaactctagctggagtc
acacatttggaggaatcagacatcattgatctggagaaacgctattggttgctaaaggct
caatcccggactggtcgatttgatttagagacgtttggcccattggtttcaccacccatt
cgtccatctctaagtgaaggtttgtttaatgcttttgatgaaaatcgtgacaatcacata
gattttaaggagatatcttgtgggttatcagcctgttgcaggggacccctggctgaaagg
caaaaattttgcttcaaggtgtttgatgttgaccgtgatggagttctctccaaggttgaa
ctcagagacatggtggttgcacttttagaggtgtggaaggacaaccgcacagatgatatc
ccagagctgcatatggatctatctgacattgtagaaggcatattgaatgcgcatgatacc
acaaagatgggccatcttactctagaagactatcagatctggagtgtgaaaaatgttctt
gccaatgaatttttgaatctccttttccaggtgtgtcacatagttctggggttaagacca
gctactccagaagaggaaggacaaattattagaggatggttagaacgagagagcaggtac
ggtctgcaaccaggacacaattggtttatcatctccatgcagtggtggcagcagtggaaa
gaatatgtcaaatatgatgccagccctgttgtaattgagctatcatctgttctgaatgga
ggaaaatattcaattggaacagcagtacattgtatagagcagagtgaagatagaattgga
ggaggcagccttagttatgtgaacaccacagaagagaaattttcagacaacatttctact
gcatctgaagcttcggaaactgctggcagtggctttctgtattctgcgacaccaggggca
gatatgtgctttgctcgacaacataacacttctgacaataacaaccagtgtttgctagga
gccaatgggaatattttattgcatctcaatcctcagaaaccaggcgctattgataaccag
ccactagtaactcaagaaccagtaaaggctacatcactaacactagaaggaggacgattg
aaacgaaccccacagctgatccatggaagagattatgaaatggtcccagaacctgtgtgg
agagcactttatcactggtatggagcaaacctggccttacctcgacctgtgatcaagaat
agcaagacagaaatcccagagctggaattgtttcctcgatatcttctcttcctaagacag
cagcctgctactcggacgcagcagtctaacatctgggtgaatatgggtatgatcagcctg
agaatgtttcctcagcatttaccaagaggaaatgtaccttctccaaatgcaccattaaag
cgagtcttagcctatacaggctgttttagtcgaatgcaaaccatcaaggaaattcatgaa
tatctatctcagaggctacgcatcaaagaggaagatatgcgcctgtggctttacaacagt
gagaattaccttactcttctggatgatgaagatcatagattggaatatttgaaaatccaa
gatgagcagcatctggtaattgaagttcgcaataaagatatgagctggcctgaggaaatg
tcctttatagccaacagtagtaaaatagatagacacaaggttcccacagaaaaaggagcc
actggtctaagtaacctgggaaacacttgtttcatgaactcaagcatccagtgtgttagt
aacacacagccactgacacagtattttatctcagggagacatctttatgaactcaacagg
acaaatcccattggtatgaaggggcatatggctaaatgctatggggatttagtacaggaa
ctttggagtggaactcagaagaatgtcgccccattaaagcttcggtggaccatagcaaaa
tatgctcccaggtttaatgggttccagcaacaagactcccaagaacttctggcttttctc
ttggatggtcttcatgaagatctcaaccgagtccatgagaagccatacgtggagctaaag
gacagcgatggccgaccagactgggaagtagctgcagaggcctgggacaaccatctgaga
agaaatcgatcaattgttgtagatttgttccatgggcagctgaggtcccaagtcagatgc
aagacatgtgggcatataagtgtccggtttgatcctttcaattttttgtctttgccatta
ccaatggacagttatatgcacttggaaataacagttattaaactggatggtactacccct
gtacgatatggactacgactaaatatggatgaaaagtacacaggtttaaaaaaacagcta
agcgatctctgtgggcttaaatcagaacagatccttcttgcagaagtacatggttccaac
ataaagaattttcctcaggacaaccaaaaagtacgactctcagtgagtggatttttgtgt
gcatttgaaattcctattcctggatctccaatttcagcttctagtccaatacagacagat
ttctcctcttccccatctacaaatggaatgttcaccctaaccaccaatggggacttgccc
cgaccaatattcatacctaatggaatgccaaacactgttgtgccatgtggaactgagaag
aactttacaaatggaatggtgaatggtcatatgccatctgttcctgacaattcctttaca
ggctacatcattgcagtccaccgaaaaatgatgaggacagaactgtatttcctttcatct
cagaagaatcgccccagcctctttggaatgccactgattgttccatgtactgtgcatacc
cggaagaaggacttatatgatgcagtttggattcaagtgtctcgattagccagccccctc
ccacctcaggaagccagtaaccatgctcaggattgtgatgacagtatgggctatcaatat
cccttcactctacgagttgtgcagaaagatgggaactcctgtgcttggtgcccatggtat
agattttgcagaggctgtaaaattgattgtggggaagacagagctttcattggaaatgcc
tatattgctgtggattgggaccctacagctcttcacctccgctatcaaacatcacaggaa
agggttgtagatgagcatgagagtgtggaacagagtcggcgagcacaagctgagcctatc
aacctggacagctgtctccgtgctttcaccagtgaggaggagttaggggaaaacgagatg
tactactgttccaagtgtaagacccactgcttggcaaccaagaagctggatctttggagg
cttccccccatcctgattattcaccttaaacgatttcaatttgtaaatggtcgatggata
aaatcacagaaaattgttaaatttcctcgtgaaaattttgaccctagtgcttttttagta
ccaagagacccagccctttgtcagcgtaaaccactcacaccccagggggatgacctctct
gagcctagagttccatcaggagacatgaagaaagcggatgctcagaattcaactggagaa
gaggatgtgctcctgagcaagagcccatcttcactcagtgcaaacatcatcaatagccct
aaaggttcaccttcttcatcaagaaaaagtggaaccagctgtccctccagcaaaaatagc
agccctaacagtagccctaggactttggggaggagcaaagggaggctccggctaccccag
atcggcagcaaaaataaactgtcaagtagtaaggagaacttggatgccagcaaagagaat
ggggctgggcaagtttgtgagctggctgatgccttgagccgagggcacatgctggggggc
agccaaactgagctggtcacccctcaggaccacgaagtagctctggccaatggatttctc
tatgagcatgaggcatgtggcaacggctacagcaatggtcagcttgaaaaccacagtgaa
gaagacagcactgatgaccaaagagaagatgttcatgttaagcctatttataatctatat
gcaatttcgtgccattcaggaattctgggcgggggccattatgtcacttatgccaaaaac
ccaaacagcaagtggtactgttataatgacagcagctgtaaggaacttcaccctgatgaa
attgacaccgactctgcctacattcttttctatgagcagcaggggatagactatgcacaa
tttctgccaaagatcgatggcaaaaagatggcagacacaagcagcatggatgaagacttt
gagtccgattacaaaaaatactgtgtgttacagtaa

DBGET integrated database retrieval system