KEGG   Canis familiaris (dog): 480663Help
Entry
480663            CDS       T01007                                 

Gene name
PNPLA7
Definition
patatin-like phospholipase domain containing 7
Orthology
K14676  
lysophospholipid hydrolase [EC:3.1.1.5]
Organism
cfa  Canis familiaris (dog)
Pathway
Glycerophospholipid metabolism
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:cfa00564]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
9
AA seq 1431 aa AA seqDB search
MRSAPRTRQRAASLRRPMLSRAQGTAVPSRSRARPPAAPPCASGALGGFRRPARLPRSSK
SSSDWLAASNAQPRPCEGAGPPGPSQCTGRRGAGRAVEAVTGARASGARGPAMTQEEDAS
PELLGIVIGALLALALVGITVFFVYRRVNRFRQVQPTPQYRFRKRDKVMFYGRKIMRKVT
TLPHTLVGSTAAPRQRVRKRTKMLSLAKRILRFKKEYPTLQPKEPPPSLLEADLTEFDVK
NSHLPSEVLYMLKNVRVLGHFEKPLFLELCKHMVFVQLLEGEHVFQPGEPDTSIYVVQDG
RLEVCIQDADGSEVAVKEVLAGDSVHSLLSILDVITGHTAPYKTVSARAAVPSTVLRLPA
VAFQGVFEKYPETLVRVVQIIMVRLQRVTFLALHNYLGLTTELFNPESQAVHLLSVASMA
AGKAKRQACCSSEDRLERTLWPQESCDPDRGGGRAAASGPLLKRSQSSPLPSVHEEILDE
LGKAQPGDQAPFTPPGSTAGATSDLKMACDRARVLLHAEEHPGSTMASKSKKNVMVADAP
SAVFHYSEANSEETVSSRKTDAIFRAAKKDLLTLMKLDDPSLLDGRVTLLHVPGGTVVSR
QGDQDVNILFVVSGLLHVYQRKIDSEEDTCLFVVRPGEIVGQLAVLTGEPLIFTIKANRD
CSFLSISKAHFYEIMRKQPTVVLGVAHTVVKRVSSFVRQIDFALDWMEVEAGRAVYRQGD
KSDCTYIVLSGRLRSVIRKDDGKKRLAGEYGRGDLIGVVETLTHQARATTVHAVRDSELA
KLPAGALTSIKRRYPQVVTRLIHLLGEKILGSLQQGSGTGHQFGLHTAGSKWDTGNPASN
LSTVAIMPVSEDVPLTAFALELKHALSAIGPVLLLTSDNIKQRLGSAALDSIHEYRLSSW
LGQQEDIHRIVLYQADSTLTPWTQRCIRQADCILIVGLGEQEPTVGELERMLESTAVRAQ
KQLVLLHRQEGPAPARTVEWLNMRSWCSGHLHLCCPRRVFSRRSMPKLVEMYQRVFQRPP
DRHSDFSRLARVLTGNAIALVLGGGGARGCAQVGIIRALAECGIPVDMVGGTSIGAFMGA
LYSEERNYSQIRIRAKEWAEDMTSMVKTVLDLTYPITSMFSGAGFNSSICNVFKDRQIED
LWIPYFTITTDITASAMRVHTDGSLWRYVRASMSLSGYMPPLCDPKDGHLLMDGGYINNL
PADVARSMGAKVVIAIDVGSQDETDLTNYGDALSGWWLLWKRWNPLATKVKVLNMAEIQT
RLAYVCCVRQLEMVKNSEYCEYLRPPIDSYRTLDFGKFNEICEVGYQHGRTVFDIWGRSG
VLEKMLQDRQGTSKMTACDVLTCPNASFTDLAEIVSRIEPAKVATVDDESDYQTEYEEEL
PDGPKDAYADFQSAPAHLGSDSEDEPSFRHRRPGLALQNCPGTPASPNTLT
NT seq 4296 nt NT seq  +upstreamnt  +downstreamnt
atgcggtcggcgccccgcaccaggcagcgagccgcctcgctcaggaggcccatgctgagc
cgcgcccaggggaccgctgtcccgagccgctcacgcgcacggcctccagccgccccgccc
tgcgcttccggcgcccttggcggcttccggcggcccgcgcggcttccgcgcagcagcaag
agcagctccgattggctggctgcgtccaatgcacagcctcggccttgcgagggggcggga
cctccgggccccagccaatgcaccgggaggcgcggcgccggccgggcggtggaggcagtg
acgggagcgcgggcgtcgggagcgcgcggtcccgccatgacgcaagaggaggatgccagc
ccagagctgctggggattgtgattggagcactcctagccctggccctcgttggcatcacc
gtcttttttgtgtatagaagggttaaccgattccgacaggtacagcccactcctcagtac
aggttccggaagagagacaaagtgatgttttatggccggaagatcatgaggaaggtgacc
acgctgccccacacgcttgtagggagcacggccgccccccggcagcgggtgaggaagagg
accaagatgctgtctctggccaagaggattctgcgtttcaaaaaggaatacccaaccctg
cagccaaaggaaccaccaccgtccctgctggaggctgacctcacggagtttgatgtgaag
aattctcacctgccgtcagaagttctgtacatgctgaaaaatgtgcgggtcctgggccac
tttgagaagccactgttcctggaactttgcaaacacatggtctttgtgcagctactggaa
ggggaacatgtcttccagccaggagagccagataccagcatctacgtggtgcaggacggg
cgccttgaagtctgcatccaggacgcagatggcagtgaggtggcggtcaaagaggttctg
gccggagacagcgtccatagtcttctcagcatcctggatgtcatcactggccacaccgct
ccatacaaaactgtgtctgcccgtgctgctgtcccttccactgtcctccggctcccagcg
gtggctttccaaggagtttttgagaagtatcctgaaaccctggtgagggtggttcagatc
atcatggtgcggctgcagagggtcacctttctggctctgcacaactacttgggcctgacc
acagagctcttcaacccggagagccaggctgtccacctgctgtctgtggccagcatggct
gctggaaaggccaagaggcaggcctgctgcagctccgaggatcgtctggagaggaccctg
tggccccaggaatcgtgcgacccagatcgagggggcggccgtgcagcagcctcggggcct
ctgctgaaaaggagccagtcctccccactgccttctgtccatgaagagatcctggacgag
ctcggcaaggcccagccaggtgaccaggcccctttcactccaccagggagcacagcaggt
gctacctcagacctgaaaatggcgtgtgaccgtgccagagtcctgctccatgcagaggag
caccctggaagcaccatggccagcaagtccaagaagaatgtgatggtggcagacgccccg
tctgcagtcttccactactcagaggctaactcagaggagactgtctccagcaggaagaca
gatgccatcttcagagctgccaagaaagaccttctcaccctaatgaagctggatgacccc
tcgctcttggatggccgggtgacccttctccatgtgccggggggaacagtggtgtcgagg
cagggagaccaggacgtgaacatcctcttcgtggtttcggggctgctgcacgtgtaccag
cggaagattgacagcgaggaggacacctgtttgtttgtggtgcgccccggggagatagtg
ggccagctggctgtgctcacaggagagcccctcatcttcaccatcaaggccaacagggac
tgcagcttcctctccatctccaaggcacacttctatgaaatcatgcgaaagcagccgact
gtcgtcctgggcgttgcacacactgtggtgaagcgagtgtcatcctttgtgcggcagatc
gacttcgcactagattggatggaggtggaggccgggcgcgcggtgtacaggcagggggac
aagtcagactgtacctacatcgtccttagtggccggctacgctctgtcatccggaaggac
gatggcaaaaagcggctggctggggagtatggccgtggagacctcattggtgtggtggag
acgctcacccaccaggccagggcaaccacagtgcatgctgttcgggactccgagctggcc
aagcttccggcaggagccctgacatccattaaacgcaggtacccacaggttgtgactcgg
ctgattcatctcttgggtgagaagattctgggcagcctccagcagggcagtggcacaggt
caccagttcgggctgcacaccgccggcagcaagtgggacacagggaaccctgccagcaac
ctctccacagtagccatcatgcctgtgtcggaggacgtgcccctcactgcctttgccctg
gagctcaagcacgccctcagtgccatcggccctgtcctgctactgaccagcgacaacata
aaacagcgccttggctctgctgctctggacagtatccacgagtaccggctgtccagctgg
ctggggcagcaggaggacatccaccggattgtgctctaccaggcagacagcacactcaca
ccgtggacccagcgctgcatccggcaagctgactgcatcctcatcgtgggcctgggcgag
caggagccaacggtgggcgagctggagcgcatgctggagagcaccgctgtgcgcgcccag
aagcagctggtcctgctgcaccggcaggaggggcccgcacccgcccgcactgtggagtgg
ctgaacatgcggagctggtgctctggccacctgcacctctgctgcccacgccgcgtcttc
tccagaagaagcatgcccaagctggtggaaatgtaccagcgcgtcttccagaggcccccg
gatcggcactcagacttctcccgcctggctcgggtgctgactggcaacgccattgccttg
gtgctaggaggagggggggcaagaggctgtgcccaggttggcatcatccgggccctggca
gagtgtggcatccctgtggacatggtcggagggacatctattggggccttcatgggtgcc
ctgtactccgaggagcggaactacagccagatccggatccgggccaaggagtgggctgag
gacatgacatccatggtgaagacagtgctggacttgacctaccccatcacttccatgttc
tcgggagccggctttaacagcagcatctgtaacgtcttcaaagaccggcagatcgaggac
ctgtggatcccctacttcaccatcaccacggacatcacagcctcggccatgcgggtccac
acggatggctccctgtggaggtacgtgcgtgccagcatgtccctgtcaggctacatgcct
cccctctgcgaccccaaggatggacacctgctgatggatggcgggtacatcaacaacctg
ccagcggatgtggccagatctatgggggcaaaggtggtgattgccatcgacgtgggcagc
caggatgagacggacctcaccaactatggcgatgcactgtctgggtggtggctgctgtgg
aagcgttggaaccccttggccacaaaagtcaaggtgttgaacatggcagagatccagaca
cgcctggcctatgtgtgctgcgtccggcagctggagatggtgaagaacagcgagtactgt
gagtacctgcgtccccccatcgacagctacaggactctggacttcggcaaattcaacgag
atttgtgaagtggggtaccagcatgggcggacagtgtttgatatctggggtcgaagcggt
gtgctagaaaagatgctacaggaccgacaggggacaagcaagatgacagcgtgtgacgtc
ctcacctgccccaatgcctccttcactgaccttgctgagattgtgtcacgcattgagccc
gccaaggtagccacagtggatgatgagtctgactaccagacggagtatgaggaagagctg
ccagatggccccaaggacgcctatgctgacttccagagtgccccagcccacctgggctca
gactcggaggacgagccctcgtttcggcatcggcgccctggtttagctttgcagaactgt
cctgggactcctgcttcccctaacactctgacctag

DBGET integrated database retrieval system