KEGG   Canis familiaris (dog): 480673Help
Entry
480673            CDS       T01007                                 

Gene name
TRAF2, TANK
Definition
TNF receptor-associated factor 2
Orthology
K03173  
TNF receptor-associated factor 2
Organism
cfa  Canis familiaris (dog)
Pathway
MAPK signaling pathway
NF-kappa B signaling pathway
Protein processing in endoplasmic reticulum
Apoptosis
Osteoclast differentiation
RIG-I-like receptor signaling pathway
TNF signaling pathway
Adipocytokine signaling pathway
Non-alcoholic fatty liver disease (NAFLD)
Hepatitis C
Herpes simplex infection
Epstein-Barr virus infection
Pathways in cancer
Viral carcinogenesis
Small cell lung cancer
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:cfa04141]
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:cfa04010]
Environmental Information Processing; Signal transduction; NF-kappa B signaling pathway [PATH:cfa04064]
Environmental Information Processing; Signal transduction; TNF signaling pathway [PATH:cfa04668]
Cellular Processes; Cell growth and death; Apoptosis [PATH:cfa04210]
Organismal Systems; Immune system; RIG-I-like receptor signaling pathway [PATH:cfa04622]
Organismal Systems; Endocrine system; Adipocytokine signaling pathway [PATH:cfa04920]
Organismal Systems; Development; Osteoclast differentiation [PATH:cfa04380]
Human Diseases; Cancers; Pathways in cancer [PATH:cfa05200]
Human Diseases; Cancers; Viral carcinogenesis [PATH:cfa05203]
Human Diseases; Cancers; Small cell lung cancer [PATH:cfa05222]
Human Diseases; Endocrine and metabolic diseases; Non-alcoholic fatty liver disease (NAFLD) [PATH:cfa04932]
Human Diseases; Infectious diseases; Hepatitis C [PATH:cfa05160]
Human Diseases; Infectious diseases; Herpes simplex infection [PATH:cfa05168]
Human Diseases; Infectious diseases; Epstein-Barr virus infection [PATH:cfa05169]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
9
AA seq 523 aa AA seqDB search
MAAASVTPPGSLDLLQPGFSKTLLGTKPEDKYLCSACRNVLRRPFQAQCGHRYCSYCLSS
ILSSGPQNCAACVHEGIYEEGISILESSSAFPDNAARREVESLPAVCPNNGCTWKGTLKE
YESCHEGHCPFMLTECPACKGLVRLGEKEHHSEHECPERSLSCRHCRAPCCWADLKAHHE
VCPKFPLTCDGCGKKKISREKFQDHVRACGKCRVPCRFHVVGCPEMVESEKQQQHEAHWL
REHLAMLLGSLLEAKHLSGAGGPFLGLSEMGGWEASTLHPEAELSKAAELQQRCEALERK
TATFENIVCVLNREVERVAMTAEACGRQHQLDQDRIEALSNKVQQLERTIGLKDLAMAEL
EQKVHEMEASTFDGVFIWKISDFARKRQEAVAGRTPAIFSPAFYTSRYGYKMCLRIYLNG
DGTGRGTHLSLFFVVMKGPNDALLRWPFNQKVTLMLLDQNNREHVIDAFRPDVTSSSFQR
PVSDMNIASGCPLFCPVSKMEAKNSYVRDDAIFIKAIVDLTGL
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
atggctgcagccagcgtgacccctcccggctccctagacttgttgcagcctggcttctcg
aagaccctcctggggaccaagccagaggacaagtacctgtgctcagcctgtaggaatgtc
ttgcgcagacccttccaggcccagtgtggccaccgctactgctcttactgcctgagcagc
atcttgagctctgggcctcagaactgtgccgcctgtgttcacgagggcatatatgaagaa
ggcatttctattttggaaagcagttcggctttcccagacaacgctgcacgcagggaggtg
gagagcctgccggccgtctgtcccaacaatggctgcacctggaaggggacccttaaagag
tatgagagctgccacgaaggacactgcccgttcatgctgactgagtgcccagcttgcaaa
ggcctggttcgcctgggggagaaagagcaccactcggagcacgagtgtccagagagaagc
ctcagctgcaggcactgccgggcaccctgctgctgggctgacttgaaggcacaccacgag
gtctgccccaagttccccttgacttgcgatggctgtggcaagaagaagatctcacgggag
aaattccaggaccacgtcagggcgtgtggcaagtgccgagtcccctgcaggttccatgtt
gtcggctgtcctgagatggtggagagcgagaagcagcagcagcacgaggcccattggctt
cgggagcacttggccatgttgctgggcagcctcctggaggcgaagcacctctcaggagct
ggtggccctttcctgggtctgagtgagatggggggctgggaagccagcacactgcacccc
gaggccgagctctccaaggccgcagaactccagcagcggtgtgaggccctagagaggaag
acggccaccttcgagaacatcgtatgtgtcctgaaccgggaggtggagagggtggccatg
accgctgaggcgtgtggccggcagcaccagctggaccaggacaggatcgaggccctgagt
aacaaggtgcagcagctggaaaggaccattggcctgaaggacctggcaatggccgaactg
gagcagaaggtccacgagatggaggcgtccacctttgatggcgtgttcatctggaagata
tctgattttgccaggaagcgccaggaagctgtggccggccgcacgcccgccatcttctcc
ccagccttctacacaagcaggtatggctacaagatgtgtctgcgcatctacctgaacgga
gacggcacggggcgtgggacacacctgtctctcttctttgtggtgatgaagggccccaat
gatgccctcctgcggtggcccttcaaccaaaaggtgaccttaatgctgctggaccagaac
aaccgggagcacgtgattgatgccttcaggcccgatgtgacctcatcctctttccagagg
ccagtcagtgacatgaacatcgccagcggctgcccccttttctgccccgtctccaagatg
gaggccaagaactcctatgtgcgcgatgacgccatcttcatcaaggccattgtggacctg
acggggctctag

DBGET integrated database retrieval system