KEGG   Canis familiaris (dog): 480673Help
Entry
480673            CDS       T01007                                 

Gene name
TRAF2
Definition
(RefSeq) TNF receptor associated factor 2
  KO
K03173  TNF receptor-associated factor 2 [EC:2.3.2.27]
Organism
cfa  Canis familiaris (dog)
Pathway
cfa04010  MAPK signaling pathway
cfa04064  NF-kappa B signaling pathway
cfa04071  Sphingolipid signaling pathway
cfa04141  Protein processing in endoplasmic reticulum
cfa04210  Apoptosis
cfa04217  Necroptosis
cfa04380  Osteoclast differentiation
cfa04621  NOD-like receptor signaling pathway
cfa04622  RIG-I-like receptor signaling pathway
cfa04657  IL-17 signaling pathway
cfa04668  TNF signaling pathway
cfa04920  Adipocytokine signaling pathway
cfa04932  Non-alcoholic fatty liver disease (NAFLD)
cfa05160  Hepatitis C
cfa05167  Kaposi's sarcoma-associated herpesvirus infection
cfa05168  Herpes simplex infection
cfa05169  Epstein-Barr virus infection
cfa05200  Pathways in cancer
cfa05203  Viral carcinogenesis
cfa05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    480673 (TRAF2)
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    480673 (TRAF2)
   04064 NF-kappa B signaling pathway
    480673 (TRAF2)
   04668 TNF signaling pathway
    480673 (TRAF2)
   04071 Sphingolipid signaling pathway
    480673 (TRAF2)
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    480673 (TRAF2)
   04217 Necroptosis
    480673 (TRAF2)
 Organismal Systems
  Immune system
   04621 NOD-like receptor signaling pathway
    480673 (TRAF2)
   04622 RIG-I-like receptor signaling pathway
    480673 (TRAF2)
   04657 IL-17 signaling pathway
    480673 (TRAF2)
  Endocrine system
   04920 Adipocytokine signaling pathway
    480673 (TRAF2)
  Development
   04380 Osteoclast differentiation
    480673 (TRAF2)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    480673 (TRAF2)
   05203 Viral carcinogenesis
    480673 (TRAF2)
   05222 Small cell lung cancer
    480673 (TRAF2)
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    480673 (TRAF2)
  Infectious diseases
   05160 Hepatitis C
    480673 (TRAF2)
   05168 Herpes simplex infection
    480673 (TRAF2)
   05167 Kaposi's sarcoma-associated herpesvirus infection
    480673 (TRAF2)
   05169 Epstein-Barr virus infection
    480673 (TRAF2)
Enzymes [BR:cfa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     480673 (TRAF2)
Messenger RNA biogenesis [BR:cfa03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Stress granule specific factors
     480673 (TRAF2)
Ubiquitin system [BR:cfa04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   TRAF proteins
    480673 (TRAF2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TRAF_BIRC3_bd zf-TRAF zf-C3HC4 zf-C3HC4_2 zf-RING_6 zf-C3HC4_4 HemX zf-RING_2 MATH SlyX Reo_sigmaC DUF1664
Motif
Other DBs
NCBI-GeneID: 480673
NCBI-ProteinID: XP_005625129
Ensembl: ENSCAFG00000019541
UniProt: J9NS71
Position
9
AA seq 523 aa AA seqDB search
MAAASVTPPGSLDLLQPGFSKTLLGTKPEDKYLCSACRNVLRRPFQAQCGHRYCSYCLSS
ILSSGPQNCAACVHEGIYEEGISILESSSAFPDNAARREVESLPAVCPNNGCTWKGTLKE
YESCHEGHCPFMLTECPACKGLVRLGEKEHHSEHECPERSLSCRHCRAPCCWADLKAHHE
VCPKFPLTCDGCGKKKISREKFQDHVRACGKCRVPCRFHVVGCPEMVESEKQQQHEAHWL
REHLAMLLGSLLEAKHLSGAGGPFLGLSEMGGWEASTLHPEAELSKAAELQQRCEALERK
TATFENIVCVLNREVERVAMTAEACGRQHQLDQDRIEALSNKVQQLERTIGLKDLAMAEL
EQKVHEMEASTFDGVFIWKISDFARKRQEAVAGRTPAIFSPAFYTSRYGYKMCLRIYLNG
DGTGRGTHLSLFFVVMKGPNDALLRWPFNQKVTLMLLDQNNREHVIDAFRPDVTSSSFQR
PVSDMNIASGCPLFCPVSKMEAKNSYVRDDAIFIKAIVDLTGL
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
atggctgcagccagcgtgacccctcccggctccctagacttgttgcagcctggcttctcg
aagaccctcctggggaccaagccagaggacaagtacctgtgctcagcctgtaggaatgtc
ttgcgcagacccttccaggcccagtgtggccaccgctactgctcttactgcctgagcagc
atcttgagctctgggcctcagaactgtgccgcctgtgttcacgagggcatatatgaagaa
ggcatttctattttggaaagcagttcggctttcccagacaacgctgcacgcagggaggtg
gagagcctgccggccgtctgtcccaacaatggctgcacctggaaggggacccttaaagag
tatgagagctgccacgaaggacactgcccgttcatgctgactgagtgcccagcttgcaaa
ggcctggttcgcctgggggagaaagagcaccactcggagcacgagtgtccagagagaagc
ctcagctgcaggcactgccgggcaccctgctgctgggctgacttgaaggcacaccacgag
gtctgccccaagttccccttgacttgcgatggctgtggcaagaagaagatctcacgggag
aaattccaggaccacgtcagggcgtgtggcaagtgccgagtcccctgcaggttccatgtt
gtcggctgtcctgagatggtggagagcgagaagcagcagcagcacgaggcccattggctt
cgggagcacttggccatgttgctgggcagcctcctggaggcgaagcacctctcaggagct
ggtggccctttcctgggtctgagtgagatggggggctgggaagccagcacactgcacccc
gaggccgagctctccaaggccgcagaactccagcagcggtgtgaggccctagagaggaag
acggccaccttcgagaacatcgtatgtgtcctgaaccgggaggtggagagggtggccatg
accgctgaggcgtgtggccggcagcaccagctggaccaggacaggatcgaggccctgagt
aacaaggtgcagcagctggaaaggaccattggcctgaaggacctggcaatggccgaactg
gagcagaaggtccacgagatggaggcgtccacctttgatggcgtgttcatctggaagata
tctgattttgccaggaagcgccaggaagctgtggccggccgcacgcccgccatcttctcc
ccagccttctacacaagcaggtatggctacaagatgtgtctgcgcatctacctgaacgga
gacggcacggggcgtgggacacacctgtctctcttctttgtggtgatgaagggccccaat
gatgccctcctgcggtggcccttcaaccaaaaggtgaccttaatgctgctggaccagaac
aaccgggagcacgtgattgatgccttcaggcccgatgtgacctcatcctctttccagagg
ccagtcagtgacatgaacatcgccagcggctgcccccttttctgccccgtctccaagatg
gaggccaagaactcctatgtgcgcgatgacgccatcttcatcaaggccattgtggacctg
acggggctctag

DBGET integrated database retrieval system