KEGG   Canis familiaris (dog): 480777Help
Entry
480777            CDS       T01007                                 

Gene name
UGT2B15, UGT2B4
Definition
(RefSeq) UDP-glucuronosyltransferase 2B31
  KO
K00699  
glucuronosyltransferase [EC:2.4.1.17]
Organism
cfa  Canis familiaris (dog)
Pathway
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Steroid hormone biosynthesis
Starch and sucrose metabolism
Retinol metabolism
Porphyrin and chlorophyll metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Metabolic pathways
Chemical carcinogenesis
Module
Glucuronate pathway (uronate pathway)
Ascorbate biosynthesis, animals, glucose-1P => ascorbate
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    480777 (UGT2B15)
   00053 Ascorbate and aldarate metabolism
    480777 (UGT2B15)
   00500 Starch and sucrose metabolism
    480777 (UGT2B15)
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    480777 (UGT2B15)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    480777 (UGT2B15)
   00860 Porphyrin and chlorophyll metabolism
    480777 (UGT2B15)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    480777 (UGT2B15)
   00982 Drug metabolism - cytochrome P450
    480777 (UGT2B15)
   00983 Drug metabolism - other enzymes
    480777 (UGT2B15)
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    480777 (UGT2B15)
Enzymes [BR:cfa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     480777 (UGT2B15)
Glycosyltransferases [BR:cfa01003]
 Others
  Hydrophobic molecule
   480777 (UGT2B15)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
Un
AA seq 546 aa AA seqDB search
MAEEGRDFRRSSASPRMSMKWISVLLLLQLSCYFSSGSCGKVLVWPTEYSHWINVKTILD
ELVQRGHEVTVLTSSVSILVDPNKLSAIKFEIYSAHLSRGDFEALFIKLLNILIYDMPKD
SFWTYFSLMQEFFWEFYECAQKLCKDVVLNKKLMTKLQESKFDVILADAVGPCGELLAEL
LKIPLVYSLRFSPGYAFEKHSGGLPLPPSYVPVILSELTDQMTFMERVKNMLYVLYFDFW
FQTINEKSWDQFYSEVLGRPTTLYELMRKADIWLIRTYWDFEYPRPLLPHFDFVGGLHCK
PAKSLPTEMEEFVQSSGENGIVVFSLGSMINNMPEERANVIASALAQIPQKVLWRFDGKK
PDNLGRNTRLYKWIPQNDLLGHPKTKAFITHGGTNGIYEAIYHGIPMVGIPLFADQADNI
VHMKAKGAAIRLDLSTMSSADLLDALRTVINDPSYKENAMKLSGIHHDQPIKPLDRAVFW
IEYVMRHQGAKHLRPASHDLTWFQYHSLDVIGFLLACVATAIFVTTQCCLFCCRKVAKTG
KKIKKE
NT seq 1641 nt NT seq  +upstreamnt  +downstreamnt
atggcagaagaaggcagggatttcagaagaagcagcgcatcccccaggatgtctatgaaa
tggatttcagtgcttctgctgctacagctgagctgttactttagctctgggagttgcgga
aaggtgctggtgtggcccacggaatacagccactggatcaatgtaaagacaatcctggat
gaacttgtccagaggggtcatgaagtgactgttctgacatcgtcagtttccattcttgtt
gatccgaacaaattatctgctattaaatttgagatttattctgcacatttatctagaggt
gattttgaggctttgttcataaaactgctcaacattttgatatatgatatgccaaaagat
tcattttggacatatttttcattaatgcaagaatttttttgggaattttatgaatgtgct
cagaagctctgtaaagatgtagttttgaacaagaaactcatgacaaaactacaagaatca
aagttcgatgtcattcttgcagacgctgtcggaccctgcggtgagctgctggctgagctc
cttaaaatacctttagtgtacagtctccgtttctctccaggctacgcatttgagaaacac
agtggaggacttcctctccctccatcctacgtacctgttattctgtcagaattaactgat
caaatgacattcatggagagagtaaaaaatatgctgtatgtgctttattttgacttttgg
ttccaaacaataaatgagaagagttgggatcagttttacagcgaagtactaggaagaccc
actacactatatgagttaatgaggaaagctgatatatggctcattcgaacctactgggat
tttgaatatcctcgcccactcctaccacattttgactttgttggaggcctccactgcaaa
cccgccaaatccctgcctacggaaatggaagagtttgtccagagctctggagaaaacggt
attgtggtgttttctctagggtcaatgatcaataacatgccagaggaaagagccaatgtg
atcgcatcagcccttgcccagattccacaaaaggttctatggagatttgatggcaagaaa
ccagacaacttagggcgaaatactcggctgtataagtggattccccagaatgaccttctt
ggtcatccgaaaaccaaagcctttataacccatggtggaaccaacggcatctatgaggcg
atctaccacgggatccccatggtgggcattcccttgtttgccgatcaagctgataacatt
gttcacatgaaagctaagggagcagctatcagactggacttgagcacaatgtctagtgca
gacttgctcgatgcattgaggacggtcattaatgacccttcgtacaaagagaatgctatg
aagttatcaggaattcaccacgatcagcctataaagcccctggaccgggcagtcttctgg
atcgagtatgtcatgcgccaccaaggagccaagcacctgcggccagcctcccatgacctc
acctggttccagtaccactccttggatgtgattgggtttctgctggcctgtgtggcaact
gctatatttgtcaccacacaatgttgtctgttttgttgtcggaaggtcgcaaaaactggg
aagaagataaaaaaggagtag

DBGET integrated database retrieval system