KEGG   Canis familiaris (dog): 480828Help
Entry
480828            CDS       T01007                                 

Gene name
ECHS1, cOR6not
Definition
(RefSeq) enoyl-CoA hydratase, short chain 1
  KO
K07511  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
cfa  Canis familiaris (dog)
Pathway
cfa00062  Fatty acid elongation
cfa00071  Fatty acid degradation
cfa00280  Valine, leucine and isoleucine degradation
cfa00310  Lysine degradation
cfa00380  Tryptophan metabolism
cfa00410  beta-Alanine metabolism
cfa00640  Propanoate metabolism
cfa00650  Butanoate metabolism
cfa01100  Metabolic pathways
cfa01200  Carbon metabolism
cfa01212  Fatty acid metabolism
Module
cfa_M00013  Malonate semialdehyde pathway, propanoyl-CoA => acetyl-CoA
cfa_M00032  Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
cfa_M00085  Fatty acid biosynthesis, elongation, mitochondria
cfa_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    480828 (ECHS1)
   00650 Butanoate metabolism
    480828 (ECHS1)
  Lipid metabolism
   00062 Fatty acid elongation
    480828 (ECHS1)
   00071 Fatty acid degradation
    480828 (ECHS1)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    480828 (ECHS1)
   00310 Lysine degradation
    480828 (ECHS1)
   00380 Tryptophan metabolism
    480828 (ECHS1)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    480828 (ECHS1)
Enzymes [BR:cfa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     480828 (ECHS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ECH_1 ECH_2 Peptidase_S49
Motif
Other DBs
NCBI-GeneID: 480828
NCBI-ProteinID: XP_537945
Position
28
AA seq 357 aa AA seqDB search
MDAAGQGGAVGWDSGFGFQAGAAQAGSQGLTGLTEAVQVGPGSWQRSCALCAARPSRLLL
FPSLFRLSLPQLAGPVHSALRPGPQCSLGTRPSLSWGADFQYIITEKKGKNSNVGLIQLN
RPKALNALCNGLMMELNQALEAFEKDPAVGAIVLTGGEKAFAAGADIKEMQNQTFQDCYS
SKFLSHWDQLAQVKKPVIAAVNGYALGGGCELAMMCDIIYAGEKAQFAQPEILLGTIPGA
GGTQRLTRAVGKSLAMEMVLTGDRISAQDAKQAGLVSKIFPVETLVEEAIRCAEKIASNS
KIVTAMAKESVNAAFEMTLTEGNRLEKKLFYATFATEDRKEGMTAFVEKRKASFKDQ
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atggatgcagcgggacagggaggagcggttggctgggacagcggcttcggcttccaggca
ggggctgcacaggccgggagccaaggacttacgggactgacggaggcggtgcaggtgggg
cctgggagctggcagaggtcctgtgctctgtgcgcagcgcgtccctcccgcctgctgctg
ttcccgagtctgttcagactctccctgccccagctggccggacctgtccactcagccctc
aggccagggccccagtgctccttggggactcggccctccctgagctggggtgctgacttc
cagtacatcatcacggagaagaaggggaagaacagcaacgtggggttgatccagctgaac
cgccccaaagcactcaacgcgctctgcaatgggctgatgatggagctcaaccaggccctg
gaggccttcgagaaggacccggccgtgggggccatcgtcctcacgggcggggagaaggcg
tttgcagctggagctgatatcaaggaaatgcagaaccaaacgttccaggactgttactcg
agcaagttcttgagccactgggaccaacttgcccaggtcaagaagccggtcatagctgcc
gtcaacggctacgctcttggtggcggctgtgaactcgctatgatgtgtgacattatttat
gctggagagaaagcccagtttgcacagccggagatcctgctaggaaccatcccaggtgca
gggggcacccagagactgacccgcgctgttggaaagtcgctggccatggagatggtcctc
accggtgaccggatctctgcccaggatgccaagcaagcaggtctcgtgagcaaaattttt
cccgtggagaccttggttgaagaagccatccggtgtgcggagaaaattgccagcaattct
aagatcgtaacagcaatggccaaggagtccgtgaacgcagcttttgaaatgacgctaacg
gagggaaacaggctggagaagaagctcttctacgcgactttcgctactgaagaccggaag
gaagggatgaccgcgtttgtggaaaagagaaaggccagcttcaaagaccagtga

DBGET integrated database retrieval system