KEGG   Canis familiaris (dog): 480828Help
Entry
480828            CDS       T01007                                 

Gene name
ECHS1, cOR6not
Definition
enoyl CoA hydratase, short chain, 1, mitochondrial
Orthology
K07511  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
cfa  Canis familiaris (dog)
Pathway
Fatty acid elongation
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Carbon metabolism
Fatty acid metabolism
Module
Malonate semialdehyde pathway, propanoyl-CoA => Acetyl-CoA
Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
Fatty acid biosynthesis, elongation, mitochondria
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    480828 (ECHS1)
   01212 Fatty acid metabolism
    480828 (ECHS1)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    480828 (ECHS1)
   00650 Butanoate metabolism
    480828 (ECHS1)
  Lipid metabolism
   00062 Fatty acid elongation
    480828 (ECHS1)
   00071 Fatty acid degradation
    480828 (ECHS1)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    480828 (ECHS1)
   00310 Lysine degradation
    480828 (ECHS1)
   00380 Tryptophan metabolism
    480828 (ECHS1)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    480828 (ECHS1)
Enzymes [BR:cfa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     480828 (ECHS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
28
AA seq 357 aa AA seqDB search
MDAAGQGGAVGWDSGFGFQAGAAQAGSQGLTGLTEAVQVGPGSWQRSCALCAARPSRLLL
FPSLFRLSLPQLAGPVHSALRPGPQCSLGTRPSLSWGADFQYIITEKKGKNSNVGLIQLN
RPKALNALCNGLMMELNQALEAFEKDPAVGAIVLTGGEKAFAAGADIKEMQNQTFQDCYS
SKFLSHWDQLAQVKKPVIAAVNGYALGGGCELAMMCDIIYAGEKAQFAQPEILLGTIPGA
GGTQRLTRAVGKSLAMEMVLTGDRISAQDAKQAGLVSKIFPVETLVEEAIRCAEKIASNS
KIVTAMAKESVNAAFEMTLTEGNRLEKKLFYATFATEDRKEGMTAFVEKRKASFKDQ
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atggatgcagcgggacagggaggagcggttggctgggacagcggcttcggcttccaggca
ggggctgcacaggccgggagccaaggacttacgggactgacggaggcggtgcaggtgggg
cctgggagctggcagaggtcctgtgctctgtgcgcagcgcgtccctcccgcctgctgctg
ttcccgagtctgttcagactctccctgccccagctggccggacctgtccactcagccctc
aggccagggccccagtgctccttggggactcggccctccctgagctggggtgctgacttc
cagtacatcatcacggagaagaaggggaagaacagcaacgtggggttgatccagctgaac
cgccccaaagcactcaacgcgctctgcaatgggctgatgatggagctcaaccaggccctg
gaggccttcgagaaggacccggccgtgggggccatcgtcctcacgggcggggagaaggcg
tttgcagctggagctgatatcaaggaaatgcagaaccaaacgttccaggactgttactcg
agcaagttcttgagccactgggaccaacttgcccaggtcaagaagccggtcatagctgcc
gtcaacggctacgctcttggtggcggctgtgaactcgctatgatgtgtgacattatttat
gctggagagaaagcccagtttgcacagccggagatcctgctaggaaccatcccaggtgca
gggggcacccagagactgacccgcgctgttggaaagtcgctggccatggagatggtcctc
accggtgaccggatctctgcccaggatgccaagcaagcaggtctcgtgagcaaaattttt
cccgtggagaccttggttgaagaagccatccggtgtgcggagaaaattgccagcaattct
aagatcgtaacagcaatggccaaggagtccgtgaacgcagcttttgaaatgacgctaacg
gagggaaacaggctggagaagaagctcttctacgcgactttcgctactgaagaccggaag
gaagggatgaccgcgtttgtggaaaagagaaaggccagcttcaaagaccagtga

DBGET integrated database retrieval system