KEGG   Canis familiaris (dog): 480885Help
Entry
480885            CDS       T01007                                 

Gene name
USP9X
Definition
ubiquitin specific peptidase 9, X-linked
Orthology
K11840  
ubiquitin carboxyl-terminal hydrolase 9/24 [EC:3.1.2.15]
Organism
cfa  Canis familiaris (dog)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
X
AA seq 1951 aa AA seqDB search
MTATTRGSPVGGNDSQGQAPDGQSQPPLQQNQTSSPDSSNENSPATPPDEQGQGDAPPQL
EDEEPAFPHTDLAKLDDMINRPRWVVPVLPKGELEVLLEAAIDLSKKGLDVKSEACQRFF
RDGLTISFTKILTDEAVSGWKFEIHRCIINNTHRLVELCVAKLSQDWFPLLELLSMALNP
HCKFHIYNGTRPCESVSSSVQLPEDELFARSPDPRSPKGWLVDLLNKFGALNGFQILHDR
FINGSALNVQIIAALIKPFGQCYEFLTLHTVKKYFLPVIEMVPQFLENLTDEELKKEAKN
EAKNDALSMIIKSLKNLASRVPGQEETVKNLEIFRLKMILRLLQISSFNGKMNALNEVNK
VISSVSYYTHRHGNPEEEEWLTAERMAEWIQQNNILSIVLRDSLHQPQYVEKLEKILRFV
IKEKALTLQDLDNIWAAQAGKHEAIVKNVHDLLAKLAWDFSPEQLDHLFDCFKASWTNAS
KKQREKLLELIRRLAEDDKDGVMAHKVLNLLWNLAHSDDVPVDIMDLALSAHIKILDYSC
SQDRDTQKIQWIDRFIEELRTNDKWVIPALKQIREICSLFGEAPQNLSQTQRSPHVFYRH
DLINQLQHNHALVTLVAENLATYMESMRLYARDHEDYDPQTVRLGSRYSHVQEVQERLNF
LRFLLKDGQLWLCAPQAKQIWKCLAENAVYLCDREACFKWYSKLMGDEPDLDPDINKDFF
ESNVLQLDPSLLTENGMKCFERFFKAVNCREGKLVAKRRAYMMDDLELIGLDYLWRVVIQ
SNDDIASRAIDLLKEIYTNLGPRLQVNQVVIHEDFIQSCFDRLKASYDTLCVLDGDKDSI
NCARQEAVRMVRVLTVLREYINECDSDYHEERTILPMSRAFRGKHLSFIVRFPNQGRQVD
DLDVWSHTNDTIGSVRRYILNRIKANVAHTKIELFVGGELIDPADDRKLIGQLNLKDKSL
ITAKLTQISSNMPSSPDSSSDSSTGSPGNHGNHYSDGPNPEVESCLPGVIMSLHPRYISF
LWQVADLGSSLNMPPLRDGARVLMKLMPPDSTTIEKLRAICLDHAKLGESSLSPSLDSLF
FGPSASQVLYLTEVVYALLMPAGAPLADDSSDFQFHFLKSGGLPLVLSMLTRNNFLPNAD
METRRGAYLNALKIAKLLLTAIGYGHVRAVAEACQPGVEGVNPMTSVNQVTHDQAVVLQS
ALQSIPNPSSECMLRNVSIRLAQQISDEASRYMPDICVIRAIQKIIWASGCGALQLVFSP
NEEITKIYEKTNAGNEPDLEDEQVCCEALEVMTLCFALIPTALDALSKEKAWQTFIIDLL
LHCHSKTVRQVAQEQFFLMCTRCCMGHRPLLFFITLLFTVLGSTARERAKHSGDYFTLLR
HLLNYAYNSNINIPNAEVLLNNEIDWLKRIRDDVKRTDETGVEETILEGHLGVTKELLAF
QTPEKKYHIGCEKGGANLIKELIDDFIFPASNVYLQYMRNGELPAEQAIPVCSSPATINA
GFELLVALAVGCVRNLKQIVDSLTEMYYIGTAITTCEALTEWEYLPPVGPRPPKGFVGLK
NAGATCYMNSVIQQLYMIPSIRNGILAIEGTGSDVDDDMSGDEKQDNESNVDPRDDVFGY
PQQFEDKPALSKTEDRKEYNIGVLRHLQVIFGHLAASRLQYYVPRGFWKQFSTDMGLYEP
NKNQTPFTTGRRESAMVAFSTSVKRTDDYYNSVTIRSQNLTTSPKIGTFKDEKASKILSD
FTNFYIWFFFRIHNALKGIPDDRDGLFDTIQRSKNHYQKRAYQCIKCMVALFSNCPVAYQ
ILQGNGDLKRKWTWAVEWLGDELERRPYTGNPQYTYNNWSPPVQSNETSNGYFLERSHSA
RMTLAKACELCPEEEPDDQDAPDEHESPPPEDAPLYPHSPGSQYQQNNHVHGQPYTGPAA
HHMNNPQRTGQRAQENYEGSEEVSPPQTKDQ
NT seq 5856 nt NT seq  +upstreamnt  +downstreamnt
atgacagccacgactcgtggctctccagtaggagggaatgacagccagggccaggctcct
gatggacagtctcagccccccctccaacagaatcagacttcatcgcctgattcttccaat
gaaaattccccggcaactcccccagatgaacaaggtcaaggtgatgccccaccacagctt
gaagatgaggaacctgcatttccacatactgacctggcgaagttggatgacatgatcaat
aggcctcgatgggtggttccagttttgccgaaaggggaattagaagtgcttttagaagct
gctattgatcttagtaaaaaaggccttgatgttaaaagtgaagcatgtcagcgatttttc
cgagatgggctaacaatatcattcactaaaatccttacagatgaggcagtgagtggctgg
aagtttgaaattcataggtgtattatcaacaatactcatcgcctggtggaactatgtgtg
gccaagttgtcccaagactggtttccacttctagaacttctctccatggccttaaatcct
cattgcaaattccatatctacaatggtacacgtccgtgtgaatccgtttcctcaagtgtt
cagttgcctgaagatgaactctttgctcgttctccagaccctcgatcaccaaaaggttgg
ctggtggatcttctcaacaagttcggcgctttaaatgggttccagattttgcatgatcgt
tttattaatggatcagcattaaatgttcaaataattgcagcccttattaaaccatttggg
caatgctatgagtttctcactcttcatacagtgaaaaagtactttcttccagtaatagaa
atggtcccacagtttttagaaaacttaactgatgaagagctgaaaaaagaagcaaagaat
gaagccaaaaatgatgctctttccatgattattaaatctttgaagaatttagcttcaagg
gttccaggacaagaagaaactgtaaaaaatttagaaatatttaggttaaaaatgatactt
agattactgcaaatatcgtcttttaatgggaagatgaatgcactgaatgaggttaataag
gtgatatctagtgtatcctattatactcatcggcatggtaaccctgaggaggaagagtgg
ctcacagctgaacgaatggcagaatggatacagcagaataatatcttatccatagtgttg
cgagatagtctgcatcaaccacagtatgtagaaaagctagagaagattcttcgttttgtc
atcaaagaaaaagctctgactttacaagatcttgataatatctgggcagcacaggcaggg
aaacatgaagccattgtgaagaatgtacatgatctactggcaaagttagcatgggatttt
tctcctgaacagcttgatcatctttttgattgctttaaggccagttggacaaatgcaagt
aaaaagcaacgtgaaaagcttcttgagctgatacgtcgccttgcagaagatgataaagat
ggtgtgatggcacacaaagtgttgaacctactgtggaatctggcccacagtgatgatgta
cctgtggatatcatggacctggctctcagtgcccacataaaaatacttgattatagttgc
tcacaggatcgtgacacacagaagatccagtggatagatcgctttatagaagagcttcgt
acgaatgacaaatgggtaattcctgcactgaaacaaattagagaaatttgtagtttgttt
ggtgaagcccctcaaaatttgagtcaaactcagcgaagtccccatgtattttatcgccat
gacttaatcaatcaacttcagcacaatcatgccctagttactttggtagcagaaaacctt
gcaacttatatggaaagcatgaggctgtatgctagagatcatgaagactatgacccacaa
actgtgaggctgggaagtagatatagtcatgtgcaagaagtccaggaacggcttaacttc
cttagatttttattgaaggatggccaactgtggctgtgtgctcctcaggcaaagcaaata
tggaaatgcttagcagaaaatgcagtgtacctttgtgatcgtgaagcctgttttaagtgg
tattccaagttgatgggggatgaaccagatttggatcctgatattaataaagacttcttt
gaaagtaatgtgcttcaacttgatccttccctattaactgaaaatggaatgaaatgtttt
gagcgattcttcaaagctgtgaattgtcgagaaggaaaactagtagcaaaaaggagagca
tatatgatggatgatttggagttaataggattagactacctttggagggttgtgattcaa
agtaatgatgatattgccagcagagctatagatctccttaaagagatatatacaaacctt
ggtccgaggctacaggtcaatcaggtggtgatccacgaagacttcattcagtcttgcttt
gatcgtttgaaagcctcttatgacacgttgtgtgtcttggatggtgacaaagacagtatt
aattgtgcaaggcaggaagctgttcgaatggttcgtgtattaactgtattaagggagtac
ataaatgaatgtgacagtgattatcacgaggaaagaacaattctacctatgtcaagagct
ttccgtggtaaacacctctcttttatagttcgatttccaaaccagggcagacaagttgat
gacttggatgtgtggtctcatacaaatgatacgattggttcagtacgacgatatattctc
aatcgtattaaagccaatgtagcccatacaaaaattgagctctttgtaggcggtgaactg
atagatcctgcagatgacagaaagttgatcggacaattaaacttaaaagataaatcgcta
attacagccaaacttacacaaataagttccaatatgccttcaagccctgatagctcttct
gattcctcaactgggtctcctggaaaccatggtaatcattacagtgatggtcccaatcca
gaagtggaaagctgtttgcctggggtgataatgtcactacatcccagatacatttctttc
ctttggcaagttgcagacttaggtagcagcctaaatatgcctcctcttagagatggagca
agagtacttatgaaacttatgccaccagatagcacaacaatagaaaaattaagagctatt
tgtttagaccacgccaaacttggagaaagcagccttagtccatctcttgactccctcttc
tttggtccttcagcctcacaagtgctgtacctaacagaggtagtctatgccttgttaatg
cctgctggtgcacccctggctgatgactcgtctgattttcaatttcacttcttaaaaagt
ggtggcctaccccttgtcctgagcatgctaaccagaaataacttcctaccaaatgcagat
atggaaactcgaaggggtgcttacctcaatgctcttaaaatagccaaactgttgctaact
gccattggctatggccatgttcgagctgtggcagaagcttgtcagccaggtgtagaaggc
gtgaatcccatgacatcggtcaaccaagttactcatgatcaagctgtggtgctgcagagt
gcccttcagagcattcctaatccatcatctgagtgcatgcttagaaatgtatccattcgt
cttgctcagcaaatatctgatgaggcttcaagatatatgcctgatatctgtgtaattaga
gctattcagaaaatcatctgggcatcaggatgtggggcattacagctagtatttagccca
aatgaagaaataactaaaatttatgagaagaccaatgcaggcaatgagccagacttggaa
gatgaacaggtttgctgtgaagcactggaagtgatgacgttatgttttgccttgattccg
acagccttagatgctcttagtaaagaaaaggcttggcagacattcattattgacttactg
ttgcactgtcacagcaaaactgttcgccaggtggcacaggagcagttctttttaatgtgc
accagatgttgcatgggacacaggcctctacttttcttcattactctgctctttaccgtg
ttggggagcacagccagagagagagctaagcattcaggcgactacttcaccctcttaagg
caccttcttaattatgcttacaacagtaatattaatatacccaatgctgaagttcttctc
aataatgaaattgattggcttaaaagaattagggatgatgttaaaagaacagatgaaaca
ggtgttgaagagactatcttagaaggccaccttggggtaacaaaagaattactggccttt
caaacccctgagaaaaagtatcatattggttgtgaaaaaggaggtgctaatctcattaaa
gaattaattgatgatttcatcttccctgcatccaatgtttacctgcaatatatgagaaac
ggagaactgcctgctgaacaggcaattccagtctgtagctccccagctaccattaatgct
ggttttgagttacttgtagcattagctgttggctgtgtgaggaatctcaaacagatagta
gattctttgactgaaatgtattacattggcacagcaataacaacttgtgaagcacttaca
gagtgggaatatctgccacctgttggaccccgcccacctaaaggatttgtgggcctgaaa
aatgctggtgctacttgttacatgaattctgtgattcagcaactctacatgattccctcc
attaggaacggtattcttgcaattgaaggcacaggtagtgatgtagatgatgatatgtct
ggggatgagaagcaggacaatgagagcaatgttgatcccagagatgatgtatttggatat
cctcaacaatttgaagacaaaccagcactgagtaaaacagaggataggaaagagtataat
attggtgttttaaggcaccttcaagtcatctttggtcatttagcagcttctcgactgcaa
tactatgtgcccagaggattttggaaacaattcagtacagatatgggtctctatgaacca
aataaaaatcaaacaccgtttactactggaaggagagaatcagccatggttgcttttagt
accagtgttaaaaggacagatgactactacaactcggtaacaatccgaagtcagaactta
acgacttcacctaaaattgggacattcaaagatgagaaagccagcaaaattctttcggat
tttacaaatttttatatttggttctttttcagaattcataatgcacttaaagggatccca
gatgaccgagatgggctgtttgacacaatccagcgctctaagaatcactatcaaaaaaga
gcataccagtgtataaaatgtatggtagctctttttagcaattgtcctgttgcttaccag
attctgcagggcaatggagatcttaaaagaaagtggacctgggcagtggaatggcttgga
gatgaacttgaaagacgaccatacactggcaatcctcaatatacttacaacaactggtct
cctccagtgcagagcaatgaaacatcaaatggttatttcttggagagatcacatagtgct
aggatgacactggcaaaagcttgtgaactctgtccagaggaggagccagatgaccaagat
gccccagatgagcatgagtcacctccacctgaagatgccccattatacccccattcacct
ggatctcagtaccaacagaataaccatgtgcatggacagccatatacaggcccagcagca
catcatatgaacaaccctcagagaactggccaacgagcacaagaaaattacgaaggcagt
gaagaagtatccccacctcagacgaaggatcagtga

DBGET integrated database retrieval system