KEGG   Canis familiaris (dog): 480901Help
Entry
480901            CDS       T01007                                 

Gene name
SPACA5, SPACA5B
Definition
sperm acrosome associated 5
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
cfa  Canis familiaris (dog)
Brite
Enzymes [BR:cfa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     480901 (SPACA5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
X
AA seq 160 aa AA seqDB search
MGVIMQAWVTMVVTLATLTVAPVDAKIYERCELAMKLEKAGLNGFKGYSIEDWLCMAHYE
SGFDTSFVDHNPDGSSEYGIFQLNSAWWCNNGVTPTQNLCHMECRDLLNRHILDDILCAR
QVASSKNGMTACPIRSRHPREEAVPSRLLYFLVGGGYSPT
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgggtgttataatgcaggcctgggtcaccatggtggtgaccctggccacgctgacagtt
gcccctgtggatgccaaaatctatgaacgctgtgaactggcaatgaagctggagaaggcg
ggcctcaacggcttcaagggctacagcattgaagactggctgtgcatggcacactatgag
agtggctttgacacctccttcgtggaccacaatcccgacggcagcagtgaatatggcatt
ttccagctgaactccgcctggtggtgtaacaatggtgttacacccacccagaacctctgt
cacatggagtgtcgtgacctgctcaaccgccatattctggatgatatcttgtgtgccagg
caggtggcatcatcaaagaatggtatgactgcctgccccatcagaagccgccatccccgt
gaggaagcagtcccctcacgtcttttgtactttttggttgggggtggatattcacccacc
taa

DBGET integrated database retrieval system