KEGG   Canis familiaris (dog): 480911Help
Entry
480911            CDS       T01007                                 

Gene name
OTUD5
Definition
OTU domain containing 5
Orthology
K12655  
OTU domain-containing protein 5 [EC:3.4.19.12]
Organism
cfa  Canis familiaris (dog)
Pathway
RIG-I-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Organismal Systems
  Immune system
   04622 RIG-I-like receptor signaling pathway
    480911 (OTUD5)
Enzymes [BR:cfa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     480911 (OTUD5)
Peptidases [BR:cfa01002]
 Cysteine Peptidases
  Family C85: DUBA deubiquitinylating enzyme
   480911 (OTUD5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
X
AA seq 567 aa AA seqDB search
MTILPKKKPPPPDADPTNEPPPPGPLPPAPRRGGGVGVGGGGTGVGGGDRDRDSGVVGAR
PRASPPPQGPLPGPPGALHRWALAVPPGAVAGPRPQQASPPPCGGPVGPGGGPGDALGAA
AAGVGAAGVVVGVGGAVGVGGCCSGPGHSKRRRQAPGVGAVAGGSPEREEVGAGYNSEDE
YEAAAARIEAMDPATVEQQEHWFEKALRDKKGFIIKQMKEDGACLFRAVADQVYGDQDMH
EVVRKHCMDYLMKNADYFSNYVTEDFTTYINRKRKNNCHGNHIEMQAMAEMYNRPVEVYQ
YSTEPINTFHGIHQNEDEPIRVSYHRNIHYNSVVNPNKATIGVGLGLPSFKPGFAEQSLM
KNAIKTSEESWIEQQMLEDKKRATDWEATNEAIEEQVARESYLQWLRDQEKQARQVRGPS
QPRKASATCSSATAAASSGLEEWTSRSPRQRSSASSPEHPELHAELGIKPPSPGTVLALA
KPPSPCAPGTSSQFSAGADRATSPLVSLYPALECRALIQQMSPSAFAGLNDWDDDEILAS
VLAVSQQEYLDSMKKNKVHRDPPPDKS
NT seq 1704 nt NT seq  +upstreamnt  +downstreamnt
atgactattctccccaaaaagaagccgccgcctcccgacgccgaccccaccaacgaaccg
ccgccgcccgggccgctgcccccggcgccgcgtcgcggcgggggtgtgggcgtgggcggc
ggcggcacgggtgtgggcggcggcgaccgcgaccgtgactcgggcgtcgtgggggcccgt
cctcgggcctcgccaccgcctcagggcccgctaccggggccaccgggagcgcttcaccgc
tgggcgctggccgtgccgcctggcgccgtggcgggtccgcggccacagcaggcctctcct
cctccctgcgggggccctgttggtcccggcggcggtcccggcgacgcgctgggcgcagca
gcggcgggtgtgggcgcggcgggcgtggtggtgggcgtgggcggagcggtaggcgttggc
ggttgctgctctgggccgggccacagcaagcgtcggcgtcaagcccccggggtcggagcg
gttgcagggggcagtccagagcgtgaggaggtcggcgcaggttataacagtgaagacgag
tatgaagcggctgctgctcgcatcgaggcaatggaccccgcaaccgtcgagcagcaggag
cactggtttgaaaaggccctgagagacaagaagggcttcatcatcaagcaaatgaaggag
gacggcgcctgtctcttccgggctgtagctgaccaggtgtatggagaccaggacatgcat
gaggttgtgcgaaagcattgcatggactatctgatgaagaatgctgactacttctccaac
tatgtaacagaggacttcaccacctacatcaacaggaagcggaaaaacaactgccatggc
aaccacattgagatgcaggccatggcagagatgtacaaccggcccgtggaggtgtaccag
tacagcacagaacccatcaacacattccatgggatccatcaaaacgaggatgaacccatc
cgcgtcagctaccatcggaatatccactacaattcagtggtgaatcccaacaaggccacc
atcggtgtggggctaggcctgccatcattcaaaccggggtttgcagaacagtccctgatg
aagaatgccataaaaacatcagaggagtcctggattgaacagcagatgctggaagacaaa
aagcgggccacagactgggaggccacaaatgaggccattgaggagcaggtggctcgagaa
tcctacctgcagtggctgcgggatcaggagaaacaggcccgccaggttcgcggccccagc
cagccccggaaagccagcgccacatgcagttctgccacagcagcagcctccagtggcctg
gaggagtggaccagccggtccccgcggcagcggagttcagcctcttcacccgagcatcct
gagctgcacgccgagctgggcatcaagcccccttccccaggcactgtcttagctcttgcc
aaacctccttcaccctgtgcaccaggtacaagcagccagttctcggcaggggccgaccga
gctacttcccccctcgtgtccctgtaccctgctctggagtgccgggctctcattcagcag
atgtccccctctgcctttgcaggtctgaatgactgggatgatgatgagatcctagcatcg
gtgctggcagtgtcccaacaggaatacctagacagtatgaagaaaaacaaagtgcacaga
gatccacccccagacaagagttga

DBGET integrated database retrieval system