KEGG   Canis familiaris (dog): 481084Help
Entry
481084            CDS       T01007                                 

Gene name
FLNA
Definition
filamin A, alpha
Orthology
K04437  
filamin
Organism
cfa  Canis familiaris (dog)
Pathway
MAPK signaling pathway
Focal adhesion
Salmonella infection
Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    481084 (FLNA)
 Cellular Processes
  Cellular commiunity
   04510 Focal adhesion
    481084 (FLNA)
 Human Diseases
  Cancers
   05205 Proteoglycans in cancer
    481084 (FLNA)
  Infectious diseases
   05132 Salmonella infection
    481084 (FLNA)
Exosome [BR:cfa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   481084 (FLNA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
X
AA seq 2646 aa AA seqDB search
MSSSHSRAGQSAAGAAPGGGADTRDAEMPATEKDLAEDAPWKKIQQNTFTRWCNEHLKCV
SKRIANLQTDLSDGLRLIALLEVLSQKKMHRKHNQRPTFRQMQLENVSVALEFLDRESIK
LVSIDSKAIVDGNLKLILGLIWTLILHYSISMPMWDEEEDEEAKKQTPKQRLLGWIQNKL
PQLPITNFSRDWQSGRALGALVDSCAPGLCPDWDSWDASKPVNNAREAMQQADDWLGIPQ
VITPEEIVDPNVDEHSVMTYLSQFPKAKLKPGAPLRPKLNPKKARAYGPGIEPTGNMVKK
RAEFTVETRSAGQGEVLVYVEDPAGHQEEAKVTANNDKNRTFSVWYVPEVTGTHKVTVLF
AGQHIAKSPFEVYVDKSQGDASKVTAQGPGLEPSGNIANKTTYFEIFTAGAGTGEVEVVI
QDPTGQKGTVEPQLEARGDSTYRCSYQPTMEGVHTVHVTFAGVPIPRSPYTVTVGQACNP
GACRAVGRGLQPKGVRVKETADFKVYTKGAGSGDLKVTVKGPKGEERVKQKDLGDGVYGF
EYYPMVPGTYTVTITWGGQNIGRSPFEVKVGTECGNQKVRAWGPGLEGGVVGKSADFVVE
AIGDDVGTLGFSVEGPSQAKIECDDKGDGSCDVRYWPQEAGEYAVHVLCNSEDIRLSPFM
ADIREAPQDFHPDRVKARGPGLEKTGVAVNKPAEFTVDAKHGGKAALRVQVQDNEGCPVD
ATVKDNGNGTYSCSYVPRKPVKHTAMVSWGGVSIPNSPFRVNVGAGSHPNKVKVYGPGVA
KTGLKAHEPTYFTVDCTEAGQGDVSIGIKCAPGVVGPTEADIDFDIIRNDNDTFTVKYTP
RGAGSYTIMVLFADQATPTSPIRVKVEPSHDASKVKAEGPGLSRTGVELGKPTHFTINAK
AAGKGKPDVQFSGLAKGDAVRDVDIIDHHDNTYTVKYTPVQQGPVGINVTYGGDPIPKSP
FSVGVSPSLDLSKIKVSGLGEKVDVGKDQEFTVKSKGAGGQGKVASKITGPSGTAVPCKV
EPGLGADNSVVRFVPREEGPYEVEVTYDGVPVPGSPFPVEALPPTKPSKVKAFGPGLQGG
SAGSPARFTIDTKGAGMGGLGLTVEGPCEAQLECLDNGDGTCSVSYVPTEPGDYNINILF
ADTHIPGSPFKAHVVPCFDASKVKCSGPGLERATAGEAGQFHVDCSSAGSAELTIEIRSE
AGLPAEVHIQDHGDGTHTITYIPLCPGAYTVTIKYGGQPVPNFPSKLQVEPAVDTSGVQC
YGPGIEGQGVFREATTEFSVDARALTQTGGPHVKARVANPSGNLTETYVQDCGDGTYKVE
YTPYEEGLHSVDVTYDGSPVPSSPFQVPVTEGCDPSRVRVHGPGIQSGTTNKPNKFTVET
RGAGTGGLGLAVEGPSEAKMSCMDNKDGSCSVEYIPYEAGTYSLNVTYGGHQVPGSPFKV
PVHDVTDASKVKCSGPGLSPGMVRANLPQSFQVDTSKAGVAPLQVKVQGPKGLVEPVDVV
DNADGTQTVNYVPSREGPYSISVLYGEEEVPRSPFKVKVLPTHDASKVKASGPGLNTTGV
PASLPVEFTIDAKDAGEGLLAVQITDPEGKPKKTHIQDNHDGTYTVAYVPDVTGRYTILI
KYGGDEIPFSPYRVRAVPTGDASKCTVTVSIGGHGLGAGIGPTIQIGEETVITVDTKAAG
KGKVTCTVCTPDGSEVDVDVVENEDGTFDIFYTAPQPGKYVICVRFGGEHVPNSPFQVTA
LAGDQPAAQPPLRPQQLAPPYTYAQGGQQTWAPERPLMGVNGLDVTSLRPFDLVIPFTIK
KGEITGEVRMPSGKVAQPAITDNKDGTVTVRYAPSEAGLHEMDIRYDNMHIPGSPLQFYV
DYVNCGHVTAYGPGLTHGVVNKPAVFTVNTKDAGEGGLSLAIEGPSKAEISCTDNQDGTC
SVSYLPVLPGDYSILVKYNEQHIPGSPFTARVTGDDSMRMSHLKVGSAADIPINISETDL
SLLTATVVPPSGREEPCLLKRLRNGHVGISFVPKETGEHLVHVKKNGQHVASSPIPVVIS
QSEIGDASRVRVSGQGLHEGHTFEPAEFIIDTRDAGYGGLSLSIEGPSKVDINTEDLEDG
TCRVTYCPTEPGNYIINIKFADQHVPGSPFSVKVTGEGRVKESITRRRRAPSVANVGSHC
NLSLKIPEISIQDMTAQVTSPSGKTHEAEIVEGENHTYCIRFVPAEMGMHTVSVKYKGQH
VPGSPFQFTVGPLGEGGAHKVRAGGPGLERAEAGVPAEFSIWTREAGAGGLAIAVEGPSK
AEISFEDRKDGSCGVAYVVQEPGDYEVSVKFNEEHIPDSPFVVPVASPSGDARRLTVSSL
QESGLKVNQPASFAVSLNGAKGAIDAKVHSPSGALEECYVTEIDQDKYAVRFIPRENGVY
LIDVKFNGTHIPGSPFKIRVGEPGHGGDPGLVSAYGAGLEGGVTGSPAEFIVNTSNAGAG
ALSVTIDGPSKVKMDCQECPEGYRVTYTPMAPGSYLISIKYGGPYHIGGSPFKAKVTGPR
LVSNHSLHETSSVFVDSLTKTASAPQHGALAGSTDASKVLAKGLGLSKAYVGQKSSFTVD
CSKAGNNMLLVGVHGPRTPCEEILVKHVGNRLYNVSYLLKDKGEYTLVVKWGDEHIPGSP
YRVLVP
NT seq 7941 nt NT seq  +upstreamnt  +downstreamnt
atgagtagctcccactcccgggcgggccagagcgcggcaggcgcggctccgggcggcggt
gccgacacgcgagacgccgagatgccagccaccgagaaggacctggccgaggacgcgccg
tggaagaagatccagcagaacacgttcacgcgctggtgcaacgagcacctgaagtgcgtg
agcaagcgcatcgccaacctgcagacggacctgagcgatgggctgcggctcatcgcgctg
ctggaggtgctcagccagaagaagatgcaccgcaagcacaaccagaggcccaccttccgc
cagatgcagctcgagaacgtgtcggtggcgctcgagttcctggaccgggagagcatcaag
ctcgtgtccatcgacagcaaggccatcgtggatgggaacctgaagctgatcttgggcctc
atctggactctgatcctgcactactccatctccatgcccatgtgggatgaggaggaggat
gaggaagccaagaagcagacgcccaagcagcgcctcctgggctggattcagaacaagctg
ccgcagctccccatcaccaacttcagccgggactggcagagcggccgggccctgggtgcc
ctcgtcgacagctgtgccccaggcctgtgtcctgactgggactcctgggacgccagcaag
cccgtgaacaacgcgagggaagccatgcagcaggctgatgactggctgggcatccctcag
gtgatcacgcccgaggaaatcgtggatcccaatgtggatgagcactccgtcatgacctac
ctgtcccagttccccaaggccaagctgaagccaggggctcccctgcggcccaaactcaac
ccgaagaaagcccgagcctacgggccaggcatcgagcccacgggcaacatggtgaagaag
cgggcggagttcacggtggagacccgaagcgcaggccagggagaggtgctggtgtacgtg
gaggaccccgccggccaccaggaggaggcgaaggtgacagccaacaacgacaagaaccgt
accttctccgtctggtacgtccccgaggtgaccgggactcacaaggtcaccgtgctcttt
gccggccagcatatcgccaagagccccttcgaggtgtatgtggacaagtcccagggtgat
gcgagcaaggtgactgcccagggccctggcctggagcccagcggcaacatcgccaacaag
accacctacttcgagatcttcacggcaggagctggcacgggtgaggtggaggtcgtgatc
caggaccctacggggcagaagggcaccgtggagcctcagctggaagcccggggcgacagc
acgtaccgctgcagctaccagcccaccatggagggcgtccacacggtgcacgtcaccttc
gctggcgtgcccatccctcgcagcccctacactgtcactgttggccaagcctgtaacccg
ggggcctgccgcgccgttggccggggcctccagcccaagggcgtgcgggtgaaggagacc
gcggacttcaaggtgtacacgaagggcgccggcagtggggacctcaaggtcaccgtgaag
ggccccaagggcgaggagcgcgtgaagcagaaggacctgggggacggcgtctacggcttc
gagtattaccccatggtccccggcacgtacaccgtcaccatcacgtggggcggccagaac
atcgggcgcagccccttcgaggtgaaggtgggcaccgagtgtggcaatcagaaggtacgg
gcctggggccccgggctggagggcggcgtcgtgggcaagtccgccgacttcgtggtggag
gccatcggggacgacgtgggcaccttaggcttctctgtggagggcccgtcgcaggccaag
atcgaatgtgatgacaagggtgacggctcctgcgatgtgcgctactggccccaggaggcc
ggcgagtacgcggtgcacgtgctgtgcaacagcgaggacatccgcctcagccccttcatg
gccgacatccgcgaggcgccccaggacttccacccggacagggtgaaggcgcgcgggcct
gggctggagaagacaggtgtggctgtcaataagccggcggagttcacggtggacgccaag
cacggcgggaaggccgccctccgggtgcaagtgcaggacaacgagggatgccccgtggac
gcaacggtcaaggacaacggcaacggcacgtacagctgctcgtacgtgcccaggaagccc
gtgaagcacacggccatggtgtcctggggcggcgtcagcattcccaacagccccttccgg
gtgaacgtgggagccgggagccacccgaacaaggtcaaggtatacgggcctggagtagcc
aagacggggctcaaggctcacgagccaacctacttcactgtggactgcactgaggccggc
cagggtgatgtcagcatcggcatcaagtgtgctcctggcgtggtgggccccactgaggcc
gacattgactttgacatcatccggaacgacaatgacaccttcacggtgaagtatacgccc
cgtggagctggtagctataccatcatggtcctctttgctgaccaggccacacccaccagc
cccatccgggtcaaggtggagccctcccatgatgccagcaaggtgaaggccgagggccct
ggcctcagtcgcactggcgttgagcttggaaaacccacccacttcacgatcaatgccaaa
gcggccggcaaaggcaagccggacgtccagttctcagggctggccaagggggacgcggtg
cgtgatgtggacatcattgaccaccacgacaacacctacacggtcaagtacactcctgtg
cagcagggtccagtgggcatcaatgtcacttatggaggggatcccatccccaagagcccc
ttctcggtgggggtgtctccgagcctagacctcagcaagatcaaggtgtctggcctggga
gagaaggtggatgtcggcaaagatcaggagttcacagtcaaatcgaagggtgccggtggc
caaggcaaagtggcgtccaagatcacgggcccctcaggcacagccgtgccctgcaaggtg
gagccaggcctgggggctgacaacagcgtggtgcgcttcgtgccccgagaggaggggccc
tatgaggtcgaggtgacttacgatggcgtgcctgtgcccggcagcccctttcctgtggaa
gcgctgcctcccaccaagcctagcaaggtgaaggcgttcgggccagggctgcaggggggc
agcgcaggctcccctgcccgcttcactatcgacaccaagggggccggcatgggcggcctg
ggcctgacggtggagggcccctgcgaggcccagctcgagtgcctggacaacggggacggc
acgtgctctgtgtcctacgtgcccaccgaacccggggactacaacatcaacatcctcttt
gctgacacccacatccccggctccccattcaaggcccacgtggttccttgcttcgatgcc
tcgaaggtcaagtgctcgggccccggcctggagcgggccacggcgggggaggccggccag
ttccacgtagactgctccagcgcgggcagcgcggagctgaccatcgaaatccgctccgag
gcggggctgccggccgaggtgcacatccaggaccacggtgacggcacacacaccatcacc
tacatcccgctctgccccggggcctatacggtcaccatcaagtacggcggccagcccgtg
cccaacttccccagcaagctgcaggtggagcctgccgtagacacctcgggcgtccagtgc
tacgggcctgggatcgagggccaaggtgtcttccgagaggctaccaccgagttcagcgtg
gacgcccgggccctgacgcagaccggagggccgcacgtcaaggcgcgtgtggccaacccc
tcgggtaacctgacggagacgtacgtgcaggactgtggcgacggcacgtacaaagtggag
tacacgccatatgaggaggggctccactccgtggacgtgacctatgatggcagccctgtg
cccagcagccccttccaagtgcctgtgaccgagggctgcgacccttcccgagtgcgggtc
catgggccaggtatccagagcggcaccaccaacaagcccaacaagttcaccgtggagacg
aggggtgccggcaccgggggcctgggcctggctgtcgagggcccctccgaggccaagatg
tcctgcatggataacaaggacggcagctgttcggtggaatacatcccctatgaggccggt
acctacagccttaacgtcacctacggtggccaccaagtaccaggcagtcctttcaaggtc
ccagtgcatgatgtgacagatgcgtccaaggtcaagtgctctgggcctggcctgagtcct
ggcatggtccgtgccaacctccctcagtccttccaggtagacacgagcaaggctggtgtg
gcccctctgcaggtgaaagtgcaggggcccaaaggcttggtggagcccgtggacgtcgtg
gacaacgctgacggcacccagaccgtcaactacgtgcccagccgggaggggccctatagc
atctccgtgctgtacggggaggaagaggtgccccgcagccccttcaaggtcaaggtgctg
cctacacacgatgccagcaaggtgaaggccagcggccccgggctcaacaccaccggtgtg
cccgccagcctgcccgtggagttcaccatcgacgcaaaggacgcgggagagggcctgctg
gccgtgcagatcacggaccccgagggcaagcccaagaagacgcacatccaagacaaccac
gatggcacgtacacggtggcctacgtgccagacgtgacgggccgctacaccatcctaatc
aagtatggtggcgacgagatccccttctccccctatcgcgtccgggctgtgcccaccggc
gacgccagcaagtgcacggtcacagtgtcaatcggaggtcacgggctaggtgctggcatt
ggccccaccatccagatcggggaggagacggtgatcaccgtcgacacgaaggcggcgggc
aagggcaaggtgacctgcacggtgtgcacacccgacggctccgaggtggacgtggacgtg
gtggagaacgaggacggcacctttgacatcttctacacggccccccagccgggcaaatac
gtcatctgcgtgcgctttggcggcgagcacgtgcccaacagccctttccaagtgacggct
ctagctggggaccagcccgcagcgcagcccccgcttcggcctcagcagctggccccacct
tacacctatgcccagggtggccagcagacctgggccccggagagacccctaatgggtgtc
aatgggttggatgtgaccagcctgaggcccttcgaccttgtcatccccttcaccatcaag
aaaggcgagatcacgggggaggtgaggatgccctcgggcaaggtggcgcagccagccatc
accgacaacaaggacggcactgtgaccgttcgctatgcacccagtgaagccggcctgcac
gagatggacatccgctatgacaacatgcacattccagggagccccctgcagttctacgtg
gattatgtcaactgcggccacgtcactgcgtacgggcctggcctcacgcacggagtggta
aacaagcctgccgtcttcaccgttaacaccaaggatgcaggagaggggggcttgtccctg
gccatcgagggcccctccaaggcagaaatcagctgtaccgacaaccaagatgggacatgc
agcgtctcctacctgcccgtgctgcccggggattacagcatcctggtcaagtacaacgag
cagcacatcccaggcagccccttcaccgccagggtcacaggtgacgactccatgcgcatg
tcccacctgaaggtgggctccgctgccgacatccccatcaatatctccgagacggacctc
agcctgctgacggccactgtcgtgcccccctcgggccgggaggagccctgtctgctgaag
cgcctgcgcaacggccacgtggggatctcgttcgtgcccaaggagacaggggagcacctg
gtgcacgtgaagaagaacggccagcacgtggccagcagccccatccctgtggtgatcagc
cagtcggagatcggggatgccagccgcgtgcgggtctccggccagggcctccacgaaggc
cacacgtttgagcctgcggagtttatcatcgacacccgtgacgcaggctatggcgggctt
agcctgtccattgagggccccagcaaggtggacatcaacacagaggacctagaggatggc
acctgcagggtcacctactgccccacggagcccggaaactacatcatcaacatcaagttc
gccgaccagcacgtgcccggcagccccttctccgtgaaggtaacgggagagggccgggtg
aaggagagcatcacgcgccggcgacgggccccgtcggtagccaacgttggcagtcactgt
aacctcagcctgaagatccccgaaattagcatccaggacatgacagcccaggtaaccagc
ccatcgggcaagacccacgaggccgagatcgtagaaggggagaaccatacctactgcatc
cgcttcgtgcctgctgagatgggcatgcacacggtcagcgtcaagtacaagggccagcac
gtgcccgggagccccttccagttcaccgtggggcccctgggggaagggggagcacacaaa
gtccgcgctggaggccccggcctggagcgggctgaagctggagtgccagctgaatttagc
atctggaccagggaagctggcgctgggggcctggccattgctgtcgagggccccagcaag
gctgagatctccttcgaggaccgcaaggacgggtcctgtggtgtggcttatgtggtccag
gagccaggtgactacgaggtctcagtcaagttcaacgaggagcacatccccgacagcccc
ttcgtagtgcctgtggcttctccgtctggcgatgcccgccgccttactgtttctagtctt
caggagtcagggctaaaggtcaaccagccagcctcttttgcagtcagcctgaacggggcc
aagggggcgatcgatgctaaggtgcacagcccctcgggagccctggaggagtgctatgtc
acagagatcgaccaagataagtatgccgtacgcttcatcccgcgggagaacggggtctac
ctaattgatgtcaagttcaatggcacccacattcctggaagccccttcaagatccgagtt
ggggagcctgggcacggaggggacccaggcctggtgtctgcctatggagccggcctagaa
ggtggtgtcacagggagcccagctgagtttatcgtgaacacgagcaacgcgggagctggt
gccctgtcggtgaccatcgatgggccctccaaggtgaagatggattgccaggagtgcccc
gagggctaccgtgtcacctacactcccatggcacctggcagctacctcatctccatcaag
tatggtggcccctaccacatcgggggcagccccttcaaggccaaagtcacaggtccccgt
ctcgtcagcaaccacagcctccatgagacatcatcggtgtttgtggactccctgaccaag
actgccagcgccccccagcacggggccctggcaggttccactgatgccagcaaggtgctg
gccaagggcctggggctgagcaaggcctatgtgggccaaaagagcagcttcacggtggac
tgcagcaaagcaggcaacaacatgctgctggtaggggtgcacggcccccggacgccctgc
gaggagatcctggtgaagcacgtgggcaaccggctctacaacgtgtcttacctactcaag
gacaagggagaatacacgctggtggtcaagtggggtgacgagcacatcccgggcagcccc
taccgtgtcctggtcccctga

DBGET integrated database retrieval system