KEGG   Canis familiaris (dog): 481105Help
Entry
481105            CDS       T01007                                 

Gene name
ERBB3
Definition
v-erb-b2 avian erythroblastic leukemia viral oncogene homolog 3
Orthology
K05084  
receptor tyrosine-protein kinase erbB-3 [EC:2.7.10.1]
Organism
cfa  Canis familiaris (dog)
Pathway
ErbB signaling pathway
Calcium signaling pathway
Endocytosis
Proteoglycans in cancer
MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Environmental Information Processing
  Signal transduction
   04012 ErbB signaling pathway
    481105 (ERBB3)
   04020 Calcium signaling pathway
    481105 (ERBB3)
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    481105 (ERBB3)
 Human Diseases
  Cancers
   05206 MicroRNAs in cancer
    481105 (ERBB3)
   05205 Proteoglycans in cancer
    481105 (ERBB3)
Enzymes [BR:cfa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     481105 (ERBB3)
Protein kinases [BR:cfa01001]
 Tyrosine protein kinases
  EGFR family [OT]
   481105 (ERBB3)
Enzyme-linked receptors [BR:cfa01020]
 Receptor tyrosine kinases
  RTK class I (EGF receptor family)
   481105 (ERBB3)
Cytokine receptors [BR:cfa04050]
 Receptor tyrosine kinase
  RTK class I (EGF receptor family)
   481105 (ERBB3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
10
AA seq 1457 aa AA seqDB search
MGAASFQGPGFEAPSPPPAPFPVGGARASAVPAAPRPGPREGPGATPARLAWPGDEPRLQ
RRPPPLPGGPPPRPGSDCAPQPPRRRCRSLAAQVAPLGCPSRGPRDGSRGASAASAGLMR
ATAPLQVLGFLLSLVRASYVGNSQAVCPGTLNGLSVTGDAENQYQTLYKLYERCEVVMGN
LEIVLTGHNADLSFLQWIREVTGYVLVAMNEFPTLPLPNLRVVRGTQVYDGKFAIFVMLN
YNTNSSHALRQLRFTQLTEILAGGVYIEKNDKLCHMDTIDWRDIVRDRDAEIVVKDNGRS
CPPCHETCKGRCWGPRPEDCQTLTKTICAPQCNGHCFGPNPNQCCHDECAGGCSGPQDTD
CFACRLFNDSGACVRQCPQPLVYNKLTFQLEPNPHTKYQYGGVCVASCPHNFVVDQTSCV
RACPPXQMEVDKNGSKMCEPCGGLCPKACEGTGSGSRFQTVDSSNIDGFVNCTKILGNLD
FLITGLNGDPWHKIPALDPEKLNVFRTVREITGYLNIQSWPPHMHNFSVFSNLTTIGGRS
LYNRGFSLLIMKNLNITSLGLRSLKEISAGRIYISANKQLCYHHSLNWTRLLRGPPEERL
DIKHNRPRRDCVAEGKVCDPLCSSGGCWGPGPGQCLSCRNYSRGGVCVTHCNFLNGEPRE
FAHEAECFSCHPECQPMEGTATCNGSGSDACAQCAHFRDGPHCVSSCPNGVLGAKGPIYK
YPDTHNECRPCHENCTQGCKGPELQDCLGQTLALISKTHLAVGLTVVVGLAVIFLILGGT
LLYWRGRRIQNKRAMRRYLERGESIEPLDPSEKANKVLARIFKETELRKLKVLGSGVFGT
VHKGVWIPEGESIKIPVCIKVIEDKSGRQSFQDVTDHMLAIGSLDHAHIVRLLGLCPGSS
LQLVTQYLPLGSLLDHVRQHRGALGPQLLLNWGVQIAKGMYYLEEHGMVHRNLAARNVLL
KSPSQVQVADFGVADLLPPDDKQLLHSEAKTPIKWMALESIHFGKYTHQSDVWSYGVTVW
ELMTFGAEPYAGLRLAEVPDLLEKGERLAQPQICTIDVYMVMVKCWMIDENIRPTFKELA
NEFTRMARDPPRYLVIKRESGPGIPPGAEPPALTNKELEEVELEPELELDLDLETEEDGL
AATLNSALGLPVGTLNRPRGSQSLLSPSSGYMPMNQGNLGDTCQESAICGTGERCPRPAS
LHPMPRGRLASESSEGHVTGSEAELQEKASMCRSRSRSPRPRGDSAYHSQRHSLLTPVTP
LSPPGLEEEDVNGYVMPDAHLKGTPSSREGTLSSVGISSVLGTEEEEEDEEYEYMNRRRR
HSPPRHPRPSSLEELGYEYMDVGSDLSASLGSTQSCPLNPVPLMPAAGTTPDEDYEYMNR
RHAGGAPGGDYAAMGACPAAEQGYEEMRAFQGPGNHAPHVHCARLKPLRSLEATDSAFDN
PDYWHSRLFPKADAQRT
NT seq 4374 nt NT seq  +upstreamnt  +downstreamnt
atgggcgcggccagctttcaggggccgggcttcgaggcgccctccccgcccccagcacct
ttccccgtcggaggcgctagggcgtctgcagtcccggccgcccctcggcccggcccccgg
gaaggtccgggcgcgaccccggctcggctcgcgtggcccggggacgagccccggctgcag
cgccgcccccctcccctgcccggcgggcccccgccccggcccggctccgattgcgctccg
cagcctccccgccgccgctgccggtcgctggcggctcaggtggccccgctcggatgtcct
agtcggggcccccgggacggatcccgcggggcctccgccgcctccgccggcctcatgagg
gcgacagcgccgctgcaggtgctgggcttcctgctcagcttggtccgcgcctcctacgtg
ggcaactcccaggcagtgtgtcccgggactctgaacgggctgagcgtgaccggcgacgct
gagaaccaataccagaccctgtacaagctctacgagcggtgcgaggtggtgatggggaac
ctcgagatcgtgctcacagggcacaatgccgacctctccttcctgcagtggatccgagaa
gtgaccggctatgtcctggtggccatgaacgagttccccaccctgcccctgcccaacctc
cgggtggtgcggggcactcaggtgtacgacgggaagttcgccatcttcgtcatgctcaac
tataacaccaactccagccatgccctgcgccagctccgcttcactcagctcacggagatt
ctggcggggggagtgtatattgagaagaacgacaagctttgtcacatggacacgatcgac
tggagggacatcgtgagggaccgagacgcagagatagtggtgaaggacaacggcaggagc
tgtcccccgtgtcatgagacctgcaaggggcgatgctggggtcctagaccagaagactgc
cagacattgaccaagaccatctgtgcccctcagtgtaatggtcattgctttgggcccaac
cccaaccagtgctgccatgatgagtgtgcagggggctgctcaggccctcaggatacagac
tgctttgcctgccgactcttcaatgacagcggggcctgtgtgcgccagtgtccacagcct
ctggtctacaacaagctaactttccagctggaacccaatccccacaccaagtatcagtat
ggtggagtttgtgtagccagctgtccccataactttgtggtcgatcaaacgtcttgtgtc
cgggcctgtcctccctgacagatggaagtagataaaaatggctccaagatgtgtgaacct
tgtggggggctgtgccccaaagcctgtgaggggacaggctccgggagccgcttccagact
gtggactcgagcaacattgatggatttgtgaactgcaccaagatcctgggcaacctggac
tttctgatcactggcctcaatggagacccctggcacaagatccctgccttggaccctgag
aagctcaatgtcttccggacagtacgggagatcacaggttacctgaacatccagtcctgg
cctccccacatgcacaacttcagtgtcttttccaacctgacaaccattgggggcagaagc
ctatacaaccggggtttctctttgctgatcatgaagaacttgaatataacatctttgggc
ctccgatctttgaaagaaattagtgctgggcgtatttacataagtgccaacaagcaactc
tgctaccaccattctctgaactggaccaggctgcttcgggggcctccagaagagaggctg
gacatcaagcataatcggccccgcagagactgcgtggcagagggcaaagtgtgtgatccc
ctgtgctcctctgggggatgctggggcccaggtcctggtcagtgcctgtcctgtcgaaac
tacagccgaggaggtgtctgtgtgacccactgcaactttctaaatggggagcctcgtgag
tttgcccatgaagctgaatgcttctcctgccacccggagtgccaacccatggaggggact
gccacatgcaatggctcgggctctgatgcctgtgctcagtgtgcccattttcgagatggg
ccgcactgtgtgagcagctgccccaatggagtcctcggtgccaagggccccatctacaag
tacccagacactcacaatgaatgtcggccctgccacgagaattgcacccaggggtgtaag
ggaccagagctacaagactgtttaggtcaaacactggcactgatcagcaaaacccatctg
gcagtgggcttaacagtggtagtgggattggcagtgattttcctgatcctgggaggcact
ttactctattggcgtgggcgccggattcagaataagagggctatgcggcgctacttggaa
cggggtgagagcatagagcctctggatcccagtgagaaggctaacaaagtcttggccaga
atcttcaaagaaacagagctgaggaagcttaaagtccttggctcaggcgtctttggaacc
gtgcacaaaggagtatggattcctgagggtgaatcaatcaagattccagtctgcattaaa
gtcatcgaggacaagagtggacggcagagttttcaagatgtgacggatcatatgctggcc
attggcagcctagaccatgcccacattgtacggctgctgggactgtgcccagggtcatct
ctgcagctcgtcactcagtacttgcctctgggttccctgctggatcatgtgagacaacac
cgtggagcactggggccccagctgctgctcaattggggagtacagattgccaaggggatg
tactaccttgaggagcatggtatggtgcataggaacctggcggcccgaaatgtgctactg
aagtcaccaagtcaggtccaggtggcagattttggggtggctgacctgctgccccccgat
gataagcaactactacacagtgaggccaagactccaattaagtggatggccctggagagt
atccactttggaaaatacacacatcagagtgacgtctggagttatggagtgacagtttgg
gagctgatgacctttggggcagagccctatgctgggctacgattggccgaagtaccagat
ctgctagagaagggggagcgattggcacagccccagatctgtaccattgatgtctacatg
gtcatggtcaagtgctggatgattgatgagaacatccgtccaacctttaaagaactagcc
aatgagttcaccaggatggcccgagaccccccacggtatctggtcataaagagagagagt
gggcctggaattccccccggggcagagccccctgctctgacaaacaaggaactggaggag
gtggagctggagccagaactggagctagatctggacttggagacggaggaggatggcctg
gcggccacactaaactctgccctcggtttgccagttggaacacttaatcggccccgtggg
agccagagcctcttaagcccatcatctggatatatgcctatgaaccagggtaaccttggg
gacacctgccaggagtctgccatttgtgggactggtgagcggtgcccccgtccagcctct
ttgcacccaatgccacggggacgcctggcatcagagtcctcagagggccatgtgacaggg
tccgaggctgagctccaggagaaggcatcaatgtgtagaagccggagccggagcccacgg
ccacgaggagacagtgcctaccattcccagcgccacagcctgctcactcctgtcacccca
ctctccccaccagggttggaggaagaggatgtcaatggatatgtcatgccagatgcacac
ctcaaaggtactccctcctcccgggaaggcaccctttcttcagtgggcatcagttctgtc
ctgggtactgaagaagaggaggaagatgaggagtatgaatatatgaaccggaggagaaga
cacagtccacctcgtcaccctaggcccagttctctcgaggagctgggttatgagtacatg
gatgtgggatcagacctcagcgcttccctgggcagcacacagagttgcccactcaaccct
gtgcccctcatgcccgctgctggcacaaccccagatgaggactatgaatatatgaatcgg
cgacatgctggaggagctcctgggggagactatgcagccatgggggcctgcccagccgct
gagcaagggtatgaagagatgagagctttccaggggcctggaaaccatgctccgcatgtc
cactgtgcccgcctcaaacctctacgtagtttagaagccactgactccgctttcgataat
cctgattactggcatagcaggcttttccccaaggctgatgctcagagaacataa

DBGET integrated database retrieval system