KEGG   Canis familiaris (dog): 481105Help
Entry
481105            CDS       T01007                                 

Gene name
ERBB3
Definition
v-erb-b2 avian erythroblastic leukemia viral oncogene homolog 3
Orthology
K05084  
receptor tyrosine-protein kinase erbB-3 [EC:2.7.10.1]
Organism
cfa  Canis familiaris (dog)
Pathway
ErbB signaling pathway
Calcium signaling pathway
Endocytosis
Proteoglycans in cancer
MicroRNAs in cancer
Class
Environmental Information Processing; Signal transduction; ErbB signaling pathway [PATH:cfa04012]
Environmental Information Processing; Signal transduction; Calcium signaling pathway [PATH:cfa04020]
Cellular Processes; Transport and catabolism; Endocytosis [PATH:cfa04144]
Human Diseases; Cancers; MicroRNAs in cancer [PATH:cfa05206]
Human Diseases; Cancers; Proteoglycans in cancer [PATH:cfa05205]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
10
AA seq 1457 aa AA seqDB search
MGAASFQGPGFEAPSPPPAPFPVGGARASAVPAAPRPGPREGPGATPARLAWPGDEPRLQ
RRPPPLPGGPPPRPGSDCAPQPPRRRCRSLAAQVAPLGCPSRGPRDGSRGASAASAGLMR
ATAPLQVLGFLLSLVRASYVGNSQAVCPGTLNGLSVTGDAENQYQTLYKLYERCEVVMGN
LEIVLTGHNADLSFLQWIREVTGYVLVAMNEFPTLPLPNLRVVRGTQVYDGKFAIFVMLN
YNTNSSHALRQLRFTQLTEILAGGVYIEKNDKLCHMDTIDWRDIVRDRDAEIVVKDNGRS
CPPCHETCKGRCWGPRPEDCQTLTKTICAPQCNGHCFGPNPNQCCHDECAGGCSGPQDTD
CFACRLFNDSGACVRQCPQPLVYNKLTFQLEPNPHTKYQYGGVCVASCPHNFVVDQTSCV
RACPPXQMEVDKNGSKMCEPCGGLCPKACEGTGSGSRFQTVDSSNIDGFVNCTKILGNLD
FLITGLNGDPWHKIPALDPEKLNVFRTVREITGYLNIQSWPPHMHNFSVFSNLTTIGGRS
LYNRGFSLLIMKNLNITSLGLRSLKEISAGRIYISANKQLCYHHSLNWTRLLRGPPEERL
DIKHNRPRRDCVAEGKVCDPLCSSGGCWGPGPGQCLSCRNYSRGGVCVTHCNFLNGEPRE
FAHEAECFSCHPECQPMEGTATCNGSGSDACAQCAHFRDGPHCVSSCPNGVLGAKGPIYK
YPDTHNECRPCHENCTQGCKGPELQDCLGQTLALISKTHLAVGLTVVVGLAVIFLILGGT
LLYWRGRRIQNKRAMRRYLERGESIEPLDPSEKANKVLARIFKETELRKLKVLGSGVFGT
VHKGVWIPEGESIKIPVCIKVIEDKSGRQSFQDVTDHMLAIGSLDHAHIVRLLGLCPGSS
LQLVTQYLPLGSLLDHVRQHRGALGPQLLLNWGVQIAKGMYYLEEHGMVHRNLAARNVLL
KSPSQVQVADFGVADLLPPDDKQLLHSEAKTPIKWMALESIHFGKYTHQSDVWSYGVTVW
ELMTFGAEPYAGLRLAEVPDLLEKGERLAQPQICTIDVYMVMVKCWMIDENIRPTFKELA
NEFTRMARDPPRYLVIKRESGPGIPPGAEPPALTNKELEEVELEPELELDLDLETEEDGL
AATLNSALGLPVGTLNRPRGSQSLLSPSSGYMPMNQGNLGDTCQESAICGTGERCPRPAS
LHPMPRGRLASESSEGHVTGSEAELQEKASMCRSRSRSPRPRGDSAYHSQRHSLLTPVTP
LSPPGLEEEDVNGYVMPDAHLKGTPSSREGTLSSVGISSVLGTEEEEEDEEYEYMNRRRR
HSPPRHPRPSSLEELGYEYMDVGSDLSASLGSTQSCPLNPVPLMPAAGTTPDEDYEYMNR
RHAGGAPGGDYAAMGACPAAEQGYEEMRAFQGPGNHAPHVHCARLKPLRSLEATDSAFDN
PDYWHSRLFPKADAQRT
NT seq 4374 nt NT seq  +upstreamnt  +downstreamnt
atgggcgcggccagctttcaggggccgggcttcgaggcgccctccccgcccccagcacct
ttccccgtcggaggcgctagggcgtctgcagtcccggccgcccctcggcccggcccccgg
gaaggtccgggcgcgaccccggctcggctcgcgtggcccggggacgagccccggctgcag
cgccgcccccctcccctgcccggcgggcccccgccccggcccggctccgattgcgctccg
cagcctccccgccgccgctgccggtcgctggcggctcaggtggccccgctcggatgtcct
agtcggggcccccgggacggatcccgcggggcctccgccgcctccgccggcctcatgagg
gcgacagcgccgctgcaggtgctgggcttcctgctcagcttggtccgcgcctcctacgtg
ggcaactcccaggcagtgtgtcccgggactctgaacgggctgagcgtgaccggcgacgct
gagaaccaataccagaccctgtacaagctctacgagcggtgcgaggtggtgatggggaac
ctcgagatcgtgctcacagggcacaatgccgacctctccttcctgcagtggatccgagaa
gtgaccggctatgtcctggtggccatgaacgagttccccaccctgcccctgcccaacctc
cgggtggtgcggggcactcaggtgtacgacgggaagttcgccatcttcgtcatgctcaac
tataacaccaactccagccatgccctgcgccagctccgcttcactcagctcacggagatt
ctggcggggggagtgtatattgagaagaacgacaagctttgtcacatggacacgatcgac
tggagggacatcgtgagggaccgagacgcagagatagtggtgaaggacaacggcaggagc
tgtcccccgtgtcatgagacctgcaaggggcgatgctggggtcctagaccagaagactgc
cagacattgaccaagaccatctgtgcccctcagtgtaatggtcattgctttgggcccaac
cccaaccagtgctgccatgatgagtgtgcagggggctgctcaggccctcaggatacagac
tgctttgcctgccgactcttcaatgacagcggggcctgtgtgcgccagtgtccacagcct
ctggtctacaacaagctaactttccagctggaacccaatccccacaccaagtatcagtat
ggtggagtttgtgtagccagctgtccccataactttgtggtcgatcaaacgtcttgtgtc
cgggcctgtcctccctgacagatggaagtagataaaaatggctccaagatgtgtgaacct
tgtggggggctgtgccccaaagcctgtgaggggacaggctccgggagccgcttccagact
gtggactcgagcaacattgatggatttgtgaactgcaccaagatcctgggcaacctggac
tttctgatcactggcctcaatggagacccctggcacaagatccctgccttggaccctgag
aagctcaatgtcttccggacagtacgggagatcacaggttacctgaacatccagtcctgg
cctccccacatgcacaacttcagtgtcttttccaacctgacaaccattgggggcagaagc
ctatacaaccggggtttctctttgctgatcatgaagaacttgaatataacatctttgggc
ctccgatctttgaaagaaattagtgctgggcgtatttacataagtgccaacaagcaactc
tgctaccaccattctctgaactggaccaggctgcttcgggggcctccagaagagaggctg
gacatcaagcataatcggccccgcagagactgcgtggcagagggcaaagtgtgtgatccc
ctgtgctcctctgggggatgctggggcccaggtcctggtcagtgcctgtcctgtcgaaac
tacagccgaggaggtgtctgtgtgacccactgcaactttctaaatggggagcctcgtgag
tttgcccatgaagctgaatgcttctcctgccacccggagtgccaacccatggaggggact
gccacatgcaatggctcgggctctgatgcctgtgctcagtgtgcccattttcgagatggg
ccgcactgtgtgagcagctgccccaatggagtcctcggtgccaagggccccatctacaag
tacccagacactcacaatgaatgtcggccctgccacgagaattgcacccaggggtgtaag
ggaccagagctacaagactgtttaggtcaaacactggcactgatcagcaaaacccatctg
gcagtgggcttaacagtggtagtgggattggcagtgattttcctgatcctgggaggcact
ttactctattggcgtgggcgccggattcagaataagagggctatgcggcgctacttggaa
cggggtgagagcatagagcctctggatcccagtgagaaggctaacaaagtcttggccaga
atcttcaaagaaacagagctgaggaagcttaaagtccttggctcaggcgtctttggaacc
gtgcacaaaggagtatggattcctgagggtgaatcaatcaagattccagtctgcattaaa
gtcatcgaggacaagagtggacggcagagttttcaagatgtgacggatcatatgctggcc
attggcagcctagaccatgcccacattgtacggctgctgggactgtgcccagggtcatct
ctgcagctcgtcactcagtacttgcctctgggttccctgctggatcatgtgagacaacac
cgtggagcactggggccccagctgctgctcaattggggagtacagattgccaaggggatg
tactaccttgaggagcatggtatggtgcataggaacctggcggcccgaaatgtgctactg
aagtcaccaagtcaggtccaggtggcagattttggggtggctgacctgctgccccccgat
gataagcaactactacacagtgaggccaagactccaattaagtggatggccctggagagt
atccactttggaaaatacacacatcagagtgacgtctggagttatggagtgacagtttgg
gagctgatgacctttggggcagagccctatgctgggctacgattggccgaagtaccagat
ctgctagagaagggggagcgattggcacagccccagatctgtaccattgatgtctacatg
gtcatggtcaagtgctggatgattgatgagaacatccgtccaacctttaaagaactagcc
aatgagttcaccaggatggcccgagaccccccacggtatctggtcataaagagagagagt
gggcctggaattccccccggggcagagccccctgctctgacaaacaaggaactggaggag
gtggagctggagccagaactggagctagatctggacttggagacggaggaggatggcctg
gcggccacactaaactctgccctcggtttgccagttggaacacttaatcggccccgtggg
agccagagcctcttaagcccatcatctggatatatgcctatgaaccagggtaaccttggg
gacacctgccaggagtctgccatttgtgggactggtgagcggtgcccccgtccagcctct
ttgcacccaatgccacggggacgcctggcatcagagtcctcagagggccatgtgacaggg
tccgaggctgagctccaggagaaggcatcaatgtgtagaagccggagccggagcccacgg
ccacgaggagacagtgcctaccattcccagcgccacagcctgctcactcctgtcacccca
ctctccccaccagggttggaggaagaggatgtcaatggatatgtcatgccagatgcacac
ctcaaaggtactccctcctcccgggaaggcaccctttcttcagtgggcatcagttctgtc
ctgggtactgaagaagaggaggaagatgaggagtatgaatatatgaaccggaggagaaga
cacagtccacctcgtcaccctaggcccagttctctcgaggagctgggttatgagtacatg
gatgtgggatcagacctcagcgcttccctgggcagcacacagagttgcccactcaaccct
gtgcccctcatgcccgctgctggcacaaccccagatgaggactatgaatatatgaatcgg
cgacatgctggaggagctcctgggggagactatgcagccatgggggcctgcccagccgct
gagcaagggtatgaagagatgagagctttccaggggcctggaaaccatgctccgcatgtc
cactgtgcccgcctcaaacctctacgtagtttagaagccactgactccgctttcgataat
cctgattactggcatagcaggcttttccccaaggctgatgctcagagaacataa

DBGET integrated database retrieval system