KEGG   Canis familiaris (dog): 481129Help
Entry
481129            CDS       T01007                                 

Gene name
B4GALNT1
Definition
beta-1,4-N-acetyl-galactosaminyl transferase 1
Orthology
K00725  
(N-Acetylneuraminyl)-galactosylglucosylceramide N-acetylgalactosaminyltransferase [EC:2.4.1.92]
Organism
cfa  Canis familiaris (dog)
Pathway
Glycosphingolipid biosynthesis - ganglio series
Metabolic pathways
Class
Metabolism; Glycan biosynthesis and metabolism; Glycosphingolipid biosynthesis - ganglio series [PATH:cfa00604]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
10
AA seq 533 aa AA seqDB search
MRLGRRALYALVLLLACASLGLLYVSTRDAPGLRAPLALWAPLQGPPRPELPDLAPEPRY
AHIPVRIKEQVVGLLSGNNCSCESSGGSLHLPFQRQVRAIDLTKAFDPQELLAASASREQ
EFQAFLSRSQSAADQLLIASANSPLQYPLQGVEVQPLRSILVPGLSLQAASGQELYQVNL
TASLGTWNVAGEVTGVTLNGEGQPDLTLTSPGLDHLNRQLQLVIYSSQSYQANTADTVRF
STEGHEAVFTIRIRHPPNPRLYPPGSLPQGAQYNISALVTIATKTFLRYNRLRALIASIR
RFYPTVTVVIADDSDKPESIRGPHIEHYLMPFGKGWFAGRNLAVSQVTTKYVLWVDDDFV
FTARTRLERLVDVLERTPLDLVGGAVREISGFATTYRQLLSVEPGAPGHGNCLRQRRGFH
HELVGFPGCVVTDGVVNFFLARTDKVREVGFDPRLSRVAHLEFFLDGLGSLRVGSCSDVV
VDHASKLKLPWTSRDVGAETYARYRYPGSLDESQVAKHRLLFFKHRLQCMTSE
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atgcggctgggccgccgggccctctacgcgctggtgctgctgctcgcctgcgcctcgctc
gggctcctgtacgtgagcacccgggacgcgccgggcctccgggcacccctggcgctgtgg
gcgcccctgcagggcccccccaggccggaactgccggacctcgcgcctgagccccgctat
gcacacatccccgtcaggatcaaggagcaagtggtggggctgctctctgggaacaactgc
agttgtgagtccagcggagggagccttcacctccccttccagaggcaggtccgagccatt
gacctcaccaaggcctttgacccccaggagctgctggctgcctctgcctccagggagcag
gagttccaggccttcctttcaaggagccagtccgccgctgaccagctgctcatagcctcc
gccaactcccctcttcagtaccccctgcagggtgtggaggtccagcccctccggagcatc
ttggtgccagggctgagcctgcaggcagcttctggtcaggagctttaccaggtgaacctg
actgcctccttgggcacctggaatgtggcaggggaagtgactggagtgactctcaatgga
gaaggccagccagatctcaccctcaccagcccagggctggaccatctcaaccggcagcta
caactggtcatttatagcagccaaagctaccaggcaaacacagcagacacagtccggttc
tccacggagggacatgaggctgtctttaccatccgcataagacaccctcccaaccctcgg
ctttacccaccaggatctctaccccagggagcccagtacaacatcagcgccttggtcacc
attgccactaagaccttcctacgttacaatcggctccgggcgctcatcgccagcatccgc
cgcttctacccaacggtcaccgtggtcatcgccgacgacagcgacaagccggagagcatc
agaggcccccacatcgagcattatctcatgccttttggcaagggctggtttgcaggccgg
aacctggccgtatcacaggtgaccaccaagtacgtcctgtgggtggacgacgacttcgtc
ttcaccgcgcggacgcggctcgagaggcttgtggacgtgctggagcggacgccgctggac
ctggtgggcggcgcggtgcgcgagatctcgggcttcgccaccacctaccggcagctgctg
agcgtggagcccggcgcgccaggccacgggaactgcctccggcaaaggcgtggcttccac
cacgagctcgtgggctttccaggctgcgtggtcaccgacggcgtggtcaacttcttcctg
gcgcgcaccgacaaggtgcgcgaggtgggcttcgacccgcgcctcagccgcgtggcgcat
ctggaattcttcctggatgggcttggttcccttcgggtgggctcctgctcagacgtcgtt
gtggatcatgcatctaagctgaagctgccttggacatcaagggatgtgggggcagagact
tatgcccggtaccgttacccaggatcactggatgagagtcaggtggccaaacaccgccta
ctcttcttcaaacaccggctgcagtgcatgacttcagaatga

DBGET integrated database retrieval system