KEGG   Canis familiaris (dog): 481131Help
Entry
481131            CDS       T01007                                 

Gene name
CDK4
Definition
cyclin-dependent kinase 4
Orthology
K02089  
cyclin-dependent kinase 4 [EC:2.7.11.22]
Organism
cfa  Canis familiaris (dog)
Pathway
Cell cycle
p53 signaling pathway
PI3K-Akt signaling pathway
Tight junction
T cell receptor signaling pathway
Hepatitis B
Measles
HTLV-I infection
Pathways in cancer
Viral carcinogenesis
Pancreatic cancer
Glioma
Melanoma
Bladder cancer
Chronic myeloid leukemia
Small cell lung cancer
Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    481131 (CDK4)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    481131 (CDK4)
   04115 p53 signaling pathway
    481131 (CDK4)
  Cellular commiunity
   04530 Tight junction
    481131 (CDK4)
 Organismal Systems
  Immune system
   04660 T cell receptor signaling pathway
    481131 (CDK4)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    481131 (CDK4)
   05203 Viral carcinogenesis
    481131 (CDK4)
   05212 Pancreatic cancer
    481131 (CDK4)
   05214 Glioma
    481131 (CDK4)
   05220 Chronic myeloid leukemia
    481131 (CDK4)
   05218 Melanoma
    481131 (CDK4)
   05219 Bladder cancer
    481131 (CDK4)
   05222 Small cell lung cancer
    481131 (CDK4)
   05223 Non-small cell lung cancer
    481131 (CDK4)
  Infectious diseases
   05166 HTLV-I infection
    481131 (CDK4)
   05162 Measles
    481131 (CDK4)
   05161 Hepatitis B
    481131 (CDK4)
Enzymes [BR:cfa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     481131 (CDK4)
Protein kinases [BR:cfa01001]
 Serine/threonine protein kinases: CMGC group
  CDK family
   481131 (CDK4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
10
AA seq 303 aa AA seqDB search
MATPRYEPVAEIGVGAYGTVYKARDPHSGHFVALKSVRVPNGGGAGGGLPISTVREVALL
RRLEAFEHPNVVRLMDVCATARTDRETKVTLVFEHVDQDLRTYLDKAPPPGLPVETIKDL
MRQFLRGLDFLHANCIVHRDLKPENILVTSGGTVKLADFGLARIYSYQMALTPVVVTLWY
RAPEVLLQSTYATPVDMWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPR
DVSLPRGAFSPRGPRPVQTVVPEMEESGAQLLLEMLTFNPHKRISAFRALQHSYLQKAEG
NPE
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atggctactcctcggtacgagccagtggctgagattggggttggtgcctatggaacggtg
tacaaggcccgtgatccgcacagcggccacttcgtggccctcaagagcgttagagtccct
aatggaggaggtgccggagggggccttcccatcagcacagttcgtgaagtggcattgctg
aggcggctggaggcttttgagcatcccaacgttgtccggctaatggacgtctgcgccact
gcccgaaccgaccgggagaccaaagtgaccctggtgtttgagcacgtggaccaagacctg
agaacgtacctggacaaggcacccccaccgggcttgccagtggagaccatcaaggatctg
atgcgccagtttctaagaggcctagatttccttcatgccaactgcatcgttcaccgagac
ctgaagcccgagaacattctggtgaccagtggtgggacagtcaagctggctgactttggc
ctggccagaatctacagctaccagatggcacttacgcctgtggttgttacactctggtat
cgtgctccagaagttcttctgcagtctacgtatgcaacacccgtggacatgtggagtgtc
ggctgtatcttcgcagagatgtttcgtcgcaagcctctcttctgtggaaactctgaagct
gaccagttaggcaaaatctttgatctgatcgggctgcccccagaggatgactggccccga
gatgtgtctctgccccgaggagccttttcccctagagggccccgtccagtacagacagtg
gtacctgagatggaggagtctggagcacagctgctgctggagatgctgacttttaaccca
cacaagcgaatctctgccttccgagccctgcagcactcttatctacaaaaggcagaaggt
aacccagagtga

DBGET integrated database retrieval system