KEGG   Canis familiaris (dog): 481163Help
Entry
481163            CDS       T01007                                 

Gene name
PTPRR
Definition
protein tyrosine phosphatase, receptor type, R
Orthology
K04458  
receptor-type tyrosine-protein phosphatase R [EC:3.1.3.48]
Organism
cfa  Canis familiaris (dog)
Pathway
MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    481163 (PTPRR)
Enzymes [BR:cfa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     481163 (PTPRR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
10
AA seq 533 aa AA seqDB search
MDVNRLNITLLRIFRQGVAAALGLLPQQVHINRLIEKKNSVELFVSPINRKAGIPDALPS
EEVLRSLNINVLHQSLSQFGIIEVSPEKNVLQGQHEADKIWSKEGFYAVVIFLSIFVIIV
TCLMILYRLKEKFQLSLRQDKEKNQEIHLSPIALQPAQSEAKTGNSMVQPEQAPKVLNVV
VDPQGRYTPEIKATSSVCPSPFKMKPIGLQERRGSNVSLTLDMSSLGNVEPFVAIPTPRE
KVAMEYLQSASRILTRSQLRDVVASSHLLQSEFMEIPMNFVDPKEIDIPRHGTKNRYKTI
LPNPLSRVCLRPKNVTDSLSTYINANYIRGYSGKEKAFIATQGPMINTVNDFWQMVWQED
SPVIVMITKLKEKNEKCVLYWPEKRGIYGKVEVLVINVNECDNYTVRNLVLKQGSHTQHV
KHYWYTSWPDHKTPDSAQPLLQLMLDVEEDRLASTGRGPVVVHCSAGIGRTGCFIATSIG
CRQLKEEGVVDALSIVCQLRVDRGGMVQTSEQYEFVHHALCLYESRLSAETVQ
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atggatgtaaacaggctgaacataaccttgcttcggatattccgccaaggagtggccgca
gctttaggactcttaccgcagcaagtacacatcaaccgcctcattgaaaagaagaacagt
gttgaactatttgtgtctcctataaaccgaaaagcaggaattcctgatgccctgccatcg
gaggaagtgctgcgttcactcaatataaatgttttacatcagagtttatcccaatttgga
attatagaagtctcccctgagaaaaatgttttacaagggcagcacgaagcggacaaaatc
tggagcaaagaaggattttacgctgttgtcatttttctcagcatctttgttattatagta
acgtgtttgatgattctttacagattgaaagaaaagtttcagctttccttgcgacaagat
aaagagaaaaatcaggagatccacctgtcgcccattgcattacagcccgcacagtctgag
gcaaaaacaggcaacagcatggtccagcccgagcaagcccccaaggtactgaatgtggtt
gtcgaccctcaaggccgatacactcctgagatcaaagctaccagctccgtctgcccttct
cctttcaaaatgaagcccataggacttcaggagaggcgagggtccaatgtatctcttaca
ctggacatgagtagcttggggaatgtcgaaccctttgtggctatcccaaccccacgggag
aaggtagcaatggagtacctgcagtcagctagccgaatactcacaagatcacagctgagg
gacgtcgtggcaagttcacatttactccaaagcgaattcatggaaataccaatgaacttc
gtggatcccaaagaaattgacattccacgtcatggaactaaaaatcgctataagaccatt
ttgccaaatcccctcagcagagtgtgtttaagaccaaaaaatgtaactgattctttgagc
acttacattaatgctaattatattaggggctacagtggcaaagagaaggcattcatcgcc
acacagggccccatgatcaacaccgtgaatgatttctggcagatggtttggcaggaagac
agtcctgtgattgtcatgatcacaaaactcaaagaaaaaaatgagaaatgtgtactatac
tggccagaaaagagaggaatatatgggaaggttgaggttctggttatcaatgtaaatgaa
tgtgacaactatacggttcgaaaccttgtcttaaagcaaggaagtcacacccaacatgtg
aagcattactggtacacctcatggcccgatcacaagactccagacagtgcccagcccctt
ctacagctcatgctggacgttgaggaagatagacttgcttccacgggccgagggcctgtg
gttgtccactgcagcgcagggataggtagaacagggtgttttattgctacgtccatcggc
tgtcgacagttgaaagaagaaggagtcgtcgatgcgctgagcattgtctgccagcttcgt
gtggacaggggtggaatggtccaaactagtgagcagtatgaatttgtgcatcacgctctg
tgcctgtatgagagcagactttcagcagagactgtccagtga

DBGET integrated database retrieval system