KEGG   Canis familiaris (dog): 481895Help
Entry
481895            CDS       T01007                                 

Gene name
TTK
Definition
TTK protein kinase
Orthology
K08866  
serine/threonine-protein kinase TTK/MPS1 [EC:2.7.12.1]
Organism
cfa  Canis familiaris (dog)
Pathway
Cell cycle
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    481895 (TTK)
Enzymes [BR:cfa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     481895 (TTK)
Protein kinases [BR:cfa01001]
 Serine/threonine protein kinases: Other group
  TTK family
   481895 (TTK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
12
AA seq 854 aa AA seqDB search
MEAEDVGGRELTIDSIMNKVRDIKNKFKNEDLTDELSLNKVSADSTDNSGTVNQIMMMAN
NPEDWLNLLLKLEKNSVPLNDALLNKLIGRYSQAIEALPPDKYGQNESFAQIQVRFAELK
AIQEPDDARDYFHMAKANCKKFAFVHISFAQFELSQGNFKKSKQLLHKAVECGAVPLEML
EIAIQNLNLQKKQLLSEEEKKSLSVSMVLTTQEPFPNSLGHLQNRNISCDSRGQTTKARF
LYGENLPPQDAEIGHRNSLKQTNKAKRSCPFGRVPVNLLNSPDYGKTDGSVLPSFTKRQT
SGSERRDIIVSGSKSSGNDSSELRHLKSIQNINSKESLMSDEKSSELDTDSVTLKNKSES
SLLTKLEETKEHQEQNVTVSNQKQWQSVRKSECVNQNPVASSNLWQIPEVSRKVDTEKQT
IFEQPAFSVSKQSPPISAPTWTDPKSLCKTPSSSALDDYMNCFRTPVVKNDFPSACQLST
PYSQLAHFQQQQQQIPVTPLQTLQISASSTNECISVKGRMYSILKQIGSGGSSKVFQVLN
EKKQIHAIKYVNLEEADNQTIESYRNEIAYLNKLQQHSDKIIRLYDYEITDQYIYMVMEC
GNIDLNSWLKKKKSINPWERKSYWKNMLEAVYTIHQHGIVHSDLKPANFLIVDGMLKLID
FGIANQMQPDTTSIVKDSQVGTVNYMPPEAIKDMSSSRENGKSKSKISPKSDVWSLGCIL
YYMTYGKTPFQHIINQISKLHAIIDPNHEIEFPDIPEKDLQDVLKCCLIRDPKQRISIPD
LLAHPYVQIQTHPGNQMAKGTTEEMKYVLGQLVGLNSPNSILKAAKTLYDRYSSGESHDS
SSSSKTFENKWEKK
NT seq 2565 nt NT seq  +upstreamnt  +downstreamnt
atggaggctgaagacgtaggtggcagagaattgacaattgattctataatgaacaaagtg
agagatattaaaaataaatttaaaaatgaagaccttactgatgaactaagcttgaataaa
gtctctgctgattctacagataactcaggaactgttaatcaaattatgatgatggcaaac
aacccagaggactggttgaatttgttgctcaaactagagaaaaacagtgtccctctaaat
gatgctcttttaaataaattgattggtcgttatagtcaagcaattgaagccctgcctcca
gataaatatgggcaaaatgagagttttgctcaaattcaagtgagatttgctgaattaaaa
gctattcaggagccggacgatgcccgtgactactttcatatggccaaagcaaactgcaag
aaatttgctttcgtgcatatatcttttgcacaatttgaactatcgcaaggtaatttcaaa
aaaagtaaacaacttcttcataaagctgtagaatgtggagcagtaccactggaaatgctg
gaaattgccattcagaatttaaaccttcaaaagaagcagctgctttcagaggaggaaaag
aagagtttatcagtatctatggtattgactactcaagaaccattccccaattcacttgga
catttacagaataggaacatcagttgtgattccagaggacagactacaaaagccaggttt
ttgtatggagagaacttgccccctcaagatgcagagataggtcatcgaaattccttgaaa
caaacaaacaaagctaaacggtcatgcccatttggaagagtcccagttaaccttctaaat
agcccggattatgggaagacagatggttcagttttaccaagttttactaaaagacagacc
tctggatcagaacgccgagatataattgtgtctggatctaaatcaagtggaaatgattcc
agtgaattgagacatttaaagtctattcaaaatatcaattccaaggaatctctgatgtca
gatgagaagagttctgaacttgatactgattcagtaaccctaaagaataaatctgaatca
agtcttctaacaaaattagaagaaactaaggaacatcaagaacaaaatgttacagtgagt
aaccagaaacagtggcagtctgtgagaaagtcagaatgcgtaaaccagaatcctgttgca
tcctcaaatctgtggcagattccagaggtttctcgaaaagttgatacagagaaacaaacc
atttttgagcaacctgccttttcagtttcaaagcagtcaccaccaatatcagcacctaca
tggactgatccaaaatctctttgtaaaacacccagtagcagtgccttggatgattacatg
aactgttttagaactcctgttgtaaagaatgactttccatctgcttgtcagttgtcaaca
ccttacagccagcttgcacatttccagcagcaacagcagcaaatacctgttactccactt
caaactttacagatttcagcatcctcaacaaatgaatgcatttcagttaaaggaagaatg
tattctatattgaagcagataggaagcggaggctcaagtaaggtattccaggtattaaat
gaaaagaaacagatacatgccataaagtatgtaaacttagaagaagcagataatcaaaca
attgagagttaccggaatgaaattgcttatttgaataaactacaacaacacagtgataag
atcatccgactttatgattatgaaatcacggaccagtacatttacatggtaatggagtgt
ggaaatatagacctaaatagttggcttaaaaagaaaaaatccatcaatccatgggaacgt
aaaagttactggaaaaatatgttggaggcagtttatacaattcatcaacatggcattgtt
catagtgatctgaaacctgctaactttctgatagttgatggaatgctaaaactaattgat
tttggaattgcaaaccaaatgcaaccagatacaacaagtattgttaaagattctcaggtt
ggtacagttaattatatgccaccagaagcaatcaaagatatgtcttcctcaagagagaat
ggaaaatccaagtcaaagataagtcctaaaagtgacgtttggtccttaggatgcattttg
tactatatgacttatgggaagacaccatttcagcatataattaaccagatttctaaatta
catgccataattgaccctaatcatgaaatcgaatttcctgatattccagagaaggatctt
caagatgtgttaaagtgttgcttaataagggaccctaaacagaggatatccattcctgac
cttctggcgcatccatatgttcaaattcaaactcatccaggtaaccagatggctaagggt
accactgaagaaatgaaatatgttctgggccaacttgttggtctgaattctcctaactcc
attttgaaagctgctaaaactttatatgaccgctatagtagtggtgaaagtcacgattcc
tcttcatcatccaagacttttgaaaacaagtgggagaaaaaataa

DBGET integrated database retrieval system