KEGG   Canis familiaris (dog): 482178Help
Entry
482178            CDS       T01007                                 

Definition
UDP-glucuronosyltransferase 2C1-like
Orthology
K00699  
glucuronosyltransferase [EC:2.4.1.17]
Organism
cfa  Canis familiaris (dog)
Pathway
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Steroid hormone biosynthesis
Starch and sucrose metabolism
Retinol metabolism
Porphyrin and chlorophyll metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Metabolic pathways
Chemical carcinogenesis
Module
Glucuronate pathway (uronate pathway)
Ascorbate biosynthesis, animals, glucose-1P => ascorbate
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    482178
   00053 Ascorbate and aldarate metabolism
    482178
   00500 Starch and sucrose metabolism
    482178
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    482178
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    482178
   00860 Porphyrin and chlorophyll metabolism
    482178
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    482178
   00982 Drug metabolism - cytochrome P450
    482178
   00983 Drug metabolism - other enzymes
    482178
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    482178
Enzymes [BR:cfa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     482178
Glycosyltransferases [BR:cfa01003]
 Others
  Hydrophobic molecule
   482178
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
13
AA seq 525 aa AA seqDB search
MRTVKGFCVLFVLHLCFFDSGTPGKILVWPVDFSHWIGLKVILNQLQLHGHEITILIPSP
SYLFDHTKIPFNVEILQLPVTKETIMEELDTFLHMVSFELPKLSWWDRQAKLREMSHSFL
RMGKRVCNGAITNKELLSRLQAAKFDICVADPLSFCGELLAELLNIPLIYSFRFSYGNVI
ERLCAQFPIPSSYXSGLTDSTTFVQTGELVVLHDKXYFIFIFSIWDEYYSKILGKRNLKT
TTLCEIMGKAKMWLIRTYWDFEFPHPYLPNFEFVGGLHCKPAKPLPKELEEFVQSSGKDG
VVVFTLGSLIKNLTEEKANIIASALAQIPQKVLWKYTGKKPDTLGPNTQLYEWIPQNDLL
GHPKTKAFITHCGTNGIYEAIYHGIPMVGIPIFGDQPGNIARIKAKGAAVEVDLHTMTSS
NLLNALKEVINNPSYKENAMKLSRIHHDQPIKPLDRAVFWIEYVMRHQGAKHLRPASHDL
TWFQYHSLDVIGFLLACVATTIFLVTKCLFCCWKFGKTGKKNKRE
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atgaggactgtaaaaggcttctgtgttctttttgtgctgcatctgtgtttcttcgactca
ggaacacctgggaaaatacttgtgtggcccgtggattttagtcactggattggtttaaaa
gttattctgaatcaactccagcttcatggacatgagataactatcctgataccttcacca
agttatctatttgatcataccaagatcccctttaatgtggagatccttcaacttccagta
actaaagaaactatcatggaagagctcgatacctttctccacatggtttcttttgaactg
ccaaaactttcatggtgggacaggcaagcaaaactgagagaaatgagccacagtttttta
aggatgggcaaaagagtgtgcaacggtgctatcacaaataaggagttactcagcaggcta
caggcagctaagtttgatatctgtgttgctgatcccttaagtttttgtggggagttgttg
gctgagctcctcaatattccattgatatattcttttcgtttttcttatgggaatgtcatt
gagagattgtgtgctcaatttcccatcccttcttcgtatnnctcaggactgacagacagt
acgacttttgtacagactggagaattggttgtcttacatgataagtgatattttattttt
atattttctatatgggacgagtattacagcaagattttaggtaagagaaatttgaaaacc
accacactgtgtgagattatggggaaagctaaaatgtggttgatacgaacttactgggat
tttgaatttcctcacccttatttacctaattttgaatttgttggaggactgcactgcaag
cctgcaaagcccctacctaaggagttagaagaatttgtccaaagctctggaaaagatgga
gttgtggtatttactctcgggtcattgatcaaaaacctcacagaagaaaaggctaatata
attgcatcagctcttgcccagattccacagaaggttctgtggaaatacacaggaaagaaa
ccagacacattaggacccaatacccagctatatgaatggattccccagaatgatcttctt
ggtcatcccaagaccaaagcttttatcactcactgtggaactaatgggatctacgaagct
atttaccatggaatccctatggtgggaattcccatatttggtgatcagcctggtaatatt
gctcgtataaaggccaaaggggcagctgttgaagtagacttgcataccatgacgagttct
aatcttcttaatgctttgaaggaagttattaacaacccttcctataaagagaatgctatg
aaattatcaagaattcaccatgatcagcctataaagcccttggaccgagcagtcttctgg
atcgagtatgtcatgcgccaccaaggagccaagcacctgcggccagcctcccatgacctc
acctggttccagtaccactccttggatgtgattggatttctgctggcttgtgtggcaact
actatattcctggtcacaaagtgtctgttttgttgctggaaatttggaaagacaggaaag
aagaacaagagagaatag

DBGET integrated database retrieval system