KEGG   Canis familiaris (dog): 482188Help
Entry
482188            CDS       T01007                                 

Gene name
DCK
Definition
deoxycytidine kinase
Orthology
K00893  
deoxycitidine kinase [EC:2.7.1.74]
Organism
cfa  Canis familiaris (dog)
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:cfa00230]
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:cfa00240]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
13
AA seq 260 aa AA seqDB search
MATPPKRSCPSPATGSEGSRIKKIAIEGNIASGKTTFVNILKQVCEDWEVVPEPVARWCS
VRSAQGDCEELTTSQKSGGNVLQMMYEKPERWSFTFQSYACLSRIRAQLACLDGKLKDAE
KPVLFFERSIYSDRYVFAANLYESECMNETEWTIYQDWHDWMNHQFGQSLELDGIIYLRA
TPEKCLNRIYLRGRNEEQGIPLEYLEKLHYKHESWLLHRTLKTNFDFLQEIPILTLDINE
DFKDKHDGLIEKVKEFLSTL
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atggccaccccgcccaagagaagctgcccgtcccccgcgaccggctcggagggaagccgc
atcaagaaaatcgccatcgaggggaacatcgcttcagggaagacaacatttgtgaatatc
cttaaacaggtctgtgaggattgggaagtggttcctgaacctgttgcccgttggtgcagt
gttcgaagtgctcaaggtgactgtgaggaactgacaacatctcagaaaagtggtgggaat
gttcttcagatgatgtatgagaagcctgaacggtggtcttttaccttccagtcatatgcg
tgcctcagtcgaataagagcccagcttgcctgtcttgatggcaagctcaaagatgcagag
aaacctgtattattttttgaacgatctatatatagtgacaggtatgtctttgcagctaat
ctgtatgaatctgagtgcatgaatgaaacagagtggacaatttatcaagactggcatgac
tggatgaatcaccaatttggccaaagcctggaactggatggaatcatttatcttcgagcc
actccagagaaatgcttgaatagaatatatttacggggaagaaatgaagaacaaggcatt
cctcttgaatatttagagaagcttcactataagcatgagagctggctacttcatagaaca
ctgaaaaccaactttgattttctacaagaaatccctatcttaactctggatatcaatgaa
gactttaaagacaaacacgatggtcttattgaaaaggtcaaagaatttttgagcactttg
tga

DBGET integrated database retrieval system