KEGG   Canis familiaris (dog): 482188Help
Entry
482188            CDS       T01007                                 

Gene name
DCK
Definition
(RefSeq) deoxycytidine kinase
  KO
K00893  deoxycitidine kinase [EC:2.7.1.74]
Organism
cfa  Canis familiaris (dog)
Pathway
cfa00230  Purine metabolism
cfa00240  Pyrimidine metabolism
cfa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    482188 (DCK)
   00240 Pyrimidine metabolism
    482188 (DCK)
Enzymes [BR:cfa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.74  deoxycytidine kinase
     482188 (DCK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: dNK AAA_18 AAA_28 Thymidylate_kin CoaE
Motif
Other DBs
NCBI-GeneID: 482188
NCBI-ProteinID: XP_539307
Ensembl: ENSCAFG00000002931
UniProt: E2R607
Position
13
AA seq 260 aa AA seqDB search
MATPPKRSCPSPATGSEGSRIKKIAIEGNIASGKTTFVNILKQVCEDWEVVPEPVARWCS
VRSAQGDCEELTTSQKSGGNVLQMMYEKPERWSFTFQSYACLSRIRAQLACLDGKLKDAE
KPVLFFERSIYSDRYVFAANLYESECMNETEWTIYQDWHDWMNHQFGQSLELDGIIYLRA
TPEKCLNRIYLRGRNEEQGIPLEYLEKLHYKHESWLLHRTLKTNFDFLQEIPILTLDINE
DFKDKHDGLIEKVKEFLSTL
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atggccaccccgcccaagagaagctgcccgtcccccgcgaccggctcggagggaagccgc
atcaagaaaatcgccatcgaggggaacatcgcttcagggaagacaacatttgtgaatatc
cttaaacaggtctgtgaggattgggaagtggttcctgaacctgttgcccgttggtgcagt
gttcgaagtgctcaaggtgactgtgaggaactgacaacatctcagaaaagtggtgggaat
gttcttcagatgatgtatgagaagcctgaacggtggtcttttaccttccagtcatatgcg
tgcctcagtcgaataagagcccagcttgcctgtcttgatggcaagctcaaagatgcagag
aaacctgtattattttttgaacgatctatatatagtgacaggtatgtctttgcagctaat
ctgtatgaatctgagtgcatgaatgaaacagagtggacaatttatcaagactggcatgac
tggatgaatcaccaatttggccaaagcctggaactggatggaatcatttatcttcgagcc
actccagagaaatgcttgaatagaatatatttacggggaagaaatgaagaacaaggcatt
cctcttgaatatttagagaagcttcactataagcatgagagctggctacttcatagaaca
ctgaaaaccaactttgattttctacaagaaatccctatcttaactctggatatcaatgaa
gactttaaagacaaacacgatggtcttattgaaaaggtcaaagaatttttgagcactttg
tga

DBGET integrated database retrieval system