KEGG   Canis familiaris (dog): 482266Help
Entry
482266            CDS       T01007                                 

Gene name
FLNC
Definition
(RefSeq) filamin C
  KO
K04437  
filamin
Organism
cfa  Canis familiaris (dog)
Pathway
MAPK signaling pathway
Focal adhesion
Salmonella infection
Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    482266 (FLNC)
 Cellular Processes
  Cellular community - eukaryotes
   04510 Focal adhesion
    482266 (FLNC)
 Human Diseases
  Cancers
   05205 Proteoglycans in cancer
    482266 (FLNC)
  Infectious diseases
   05132 Salmonella infection
    482266 (FLNC)
Cytoskeleton proteins [BR:cfa04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Cross-linking proteins
     482266 (FLNC)
  Intermediate filaments
   Intermediate filament-binding proteins
    482266 (FLNC)
Exosome [BR:cfa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   482266 (FLNC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
14
AA seq 2720 aa AA seqDB search
MMNNSGYSEAAGLGLADEVDDMPSTEKDLAEDAPWKKIQQNTFTRWCNEHLKCVGKRLTD
LQRDLSDGLRLIALLEVLSQKRMYRKFHPRPNFRQMKLENVSVALEFLEREHIKLVSIDS
KAIVDGNLKLILGLIWTLILHYSISMPMWEDEDDEDARKQTPKQRLLGWIQNKVPQLPIT
NFNRDWQDGKALGALVDNCAPGLCPDWEAWDPNQPVENAREAMQQADDWLGVPQVIAPEE
IVDPNVDEHSVMTYLSQFPKAKLKPGAPVRSKQLNPKKAIAYGPGIEPHGNTVLQPAHFT
VQTVDAGVGEVLVYIEDPEGHTEEAKVVPNNDKNRTYAVSYVPKVAGLHKVTVLFAGQNI
ERSPFEVNVGMALGDANKVSARGPGLEPMGNVANKPTYFDIYTAGAGTGDVAVVIVDPQG
RRDTVEVALEDKGDNTFRCTYRPVMEGPHTVHVAFAGAPITRSPFPVHVAEACNPNACRA
SGRGLQPKGVRVKEVADFKVFTKGAGSGELKVTVKGPKGTEEPVKVREAGDGVFECEYYP
VVPGKYVVTITWGGYAIPRSPFEVQVSPEAGTQKVRAWGPGLKTGQVGKSADFVVEAIGT
EVGTLGFSIEGPSQAKIECDDKGDGSCDVRYWPTEPGEYAVHVICDDEDIRDSPFIAHIQ
PAAPDCFPDKVKAFGPGLEPTGCIVDKPAEFTIDARAAGKGDLNLYAQDADGCPVNIMVI
PNGDGTFRCSYVPTKPIKHTIIISWGGVNVPKSPFRVNVGEGSHPERVKVYGPGVEKTGL
KANEPTYFTVDCSEAGQGDVSIGIKCAPGVVGPAEADIDFDIIKNDNDTFTVKYTPPGAG
RYTIMVLFANQEIPASPFHIKVDPSHDASKVKAEGPGLNRTGVEVGKPTHFTVLTKGAGK
AKLDVHFAGAAKGEAVRDFEIIDNHDYSYTVKYTAVQQGNMAVTVTYGGDPVPKSPFVVN
VAPPLDLSKVKVQGLNSKVAVGQEQAFSVNTRGAGGQGQLDVRMTSPSRRPIPCKVEPGG
GAETQAVRYMPPEEGPYKVDITYDGHPVPGSPFAVEGVLPPDPSKVCAYGPGLKGGLVGS
PAPFSIDTKGAGTGGLGLTVEGPCEAKIECQDNGDGSCAVSYLPTEPGEYTINILFAEAH
IPGSPFKATIRPVFDPSKVRASGPGLERGKAGEAATFTVDCSEAGEAELTIEILSDAGVK
AEVLIHNNADGTYHITYSPAFPGTYTITIKYGGHPVPKFPTRVHVQPAVDTSGIKVSGPG
VEPHGVLREVTTEFTVDARSLTATGGNHVTARVLNPSGAKTDTYVTDNGDGTYRVQYTAY
EEGVHLVEVLYDDVAVPKSPFRVGVTEGCDPTRVRAFGPGLESGLVNKANHFTVETRGAG
TGGLGLAIEGPSEAKMSCKDNKDGSCTVEYIPFTPGDYDVNITFGGRPIPGSPFRVPVKD
VVDPGKVKCSGPGLGAGVRARVPQTFTVDCSQAGRAPLQVAVLGPTGVAEPVEVLDNGGG
THTVHYTPATDGPYTVAVKYADQEVPRSPFKIKVLPAHDASKVRASGPGLNASGIPASLP
VEFTIDARDAGEGLLTVQILDPEGKPKKANIRDNGDGTYTVSYLPDMSGRYTITIKYGGD
EIPYSPFRIHALPTGDASKCLVTVSIGGHGLGACLGPRIQIGEETVITVDAKAAGKGKVT
CTVSTPDGAELDVDVVENHDGTFDIYYTAPEPGKYVITIRFGGEHIPNSPFHVLACDPMP
HVEEPADVLQLPRPSTYPTHWATEEPVVPAEPMESMLRPFNLVIPFTVQKGELTGEVRMP
SGKTARPNITDNKDGTITVRYAPTEKGLHQMGIKYDGNHIPGSPLQFYVDAINSRHVSAY
GPGLSHGMVNKPATFTIVTKDAGEGGLSLAVEGPSKAEITCKDNKDGTCTVSYLPTAPGD
YSIIVRFDDKHIPGSPFTAKITGDDSMRTSQLNVGTSTDVSLKITESDLSLLTASIRAPS
GNEEPCLLKRLPNRHIGISFTPKEVGEHVVSVRKSGKHVTNSPFKILVGPSEIGDASKVR
VWGKGLSEGHTFQVAEFIVDTRNAGYGGLGLSIEGPSKVDINCEDMEDGTCKVTYCPTEP
GTYIINIKFADKHVPGSPFTVKVTGEGRMKESITRRRQAPSIATIGSTCDLNLKIPGNWF
QMVSAQERLTRTFTRSSHTYTRTERTEISKTRGGETKREVRVEESTQVGGDPFPAVFGDF
LGRERLGSFGSITRQQEGEASSQDMTAQVTSPSGKMEAAEIVEGEDSAYSVRFVPQEMGP
HTVTVKYRGQHVPGSPFQFTVGPLGEGGAHKVRAGGTGLERGVAGVPAEFSIWTREAGAG
GLSIAVEGPSKAEIAFEDRKDGSCGVSYVVQEPGDYEVSIKFNDEHIPDSPFVVPVASLS
DDARRLTVTSLQETGLKVNQPASFAVQLNGARGVIDARVHTPSGAVEECYVSELDSDKHT
IRFIPHENGVHSIDVKFNGAHIPGSPFKIRVGEQSQAGDPGLVSAYGPGLEGGTTGVSSE
FIVNTLNAGSGALSVTIDGPSKVQLDCRECPEGHVVTYTPMAPGNYLIAIKYGGPQHIVG
SPFKAKVTGPRLSGGHSLHETSTVLVETVTKSSSSRGSSYSSIPKFSSDASKVVTRGPGL
SQAFVGQKNSFTVDCSKAGTNMMMVGVHGPKTPCEEVYVKHMGNRVYNVTYTVKEKGDYI
LIVKWGDESVPGSPFKVNVP
NT seq 8163 nt NT seq  +upstreamnt  +downstreamnt
atgatgaacaacagcggctactcggaggccgcgggcctcggcctggccgacgaggtggac
gacatgccgtccacggagaaggacctggcggaggacgcgccgtggaagaagatccagcag
aacacgttcacgcgctggtgcaacgagcacctcaagtgcgtgggcaagcgcctgaccgac
ctgcagcgcgacctcagcgacgggctgcgcctcatcgcgctgctcgaggtgctcagccag
aagcgcatgtaccgcaagttccacccgcgccccaacttccgccagatgaagctggagaac
gtgtccgtggccctcgagttcctcgagcgcgagcacatcaagctcgtgtccatcgacagc
aaggccatcgtggatggaaacctgaagctgatcctgggtctaatctggacgctgatcctg
cactactccatctccatgcccatgtgggaggatgaggatgatgaggacgcccgcaagcag
acgcccaaacagcgtctgctcggctggatccagaacaaggtgccccaactgcccatcact
aacttcaaccgtgactggcaggacggcaaggctctgggtgccctggtggacaattgcgcc
cctggcctctgccctgactgggaggcctgggaccccaaccagcctgtggagaacgcccgg
gaggccatgcagcaggcggacgactggctcggggtgccccaggtgattgcccctgaggag
attgtggatcccaacgtggatgagcattctgtcatgacctacctgtcccagttccccaag
gccaaactcaagcctggtgcccctgttcgctctaagcagctgaacccaaagaaggccatc
gcctacgggcctggcattgagccccacggcaacacggtgctgcagcctgcccacttcact
gttcagacggtggatgccggtgtgggtgaggtgctggtctacattgaggaccctgagggc
cacaccgaggaggccaaggtggttcccaacaatgacaagaaccggacctatgctgtctcc
tatgtgcctaaggttgcggggttgcacaaggtgaccgtgctctttgctggccagaacatc
gaacgcagcccttttgaggtgaacgtgggcatggccctgggggatgccaacaaggtgtcg
gcccgtggccctggcctggagcccatgggcaatgtggccaacaaacccacctactttgac
atctacactgcgggggctgggactggtgatgttgccgtggtgatcgtggacccgcagggc
cggagggacacagtggaggtggccctggaagacaagggtgataacacattccgatgcacg
tacaggcctgtgatggaggggccccacacggtgcatgtggcctttgctggtgcccccatc
acccgcagtcctttccccgtccatgtggcagaagcctgtaaccccaatgcctgccgtgcc
tctgggcggggcctgcagcccaagggtgtgcgtgtgaaagaggtggctgacttcaaggtg
ttcacgaagggtgccggcagcggagagctcaaggtcacagtcaaggggccaaagggcaca
gaggagccagtaaaggtgcgagaggctggagatggtgtgttcgagtgtgagtactaccct
gtggtgcctgggaagtacgtggtgaccatcacatggggcggctatgctatcccccgcagc
ccctttgaggtacaggtgagcccagaggcaggaacacagaaggtacgggcctggggtcct
ggcctgaaaactggccaggtgggcaagtcagccgactttgtggtggaggccattggcacg
gaggtggggacactgggcttctccattgaggggccctcgcaggccaagattgagtgtgat
gacaagggggatggctcctgcgatgtgaggtactggcccacagagcccggagagtatgct
gtgcatgtcatctgtgatgatgaggacatccgagactcccccttcattgcccacatccag
ccagccgcacccgactgctttccagacaaggtgaaggcctttgggcccggcctggagccc
acaggctgcatcgtggacaagcctgcggagttcaccattgatgctcgtgccgctggcaag
ggagacctgaatctgtatgcccaggacgctgatggctgccctgtcaacatcatggtcatt
cccaacggcgatggcaccttccgctgctcctatgtgcccaccaagcccattaaacacacc
atcatcatttcctggggaggtgtcaacgtgcccaagagccccttccgggtaaatgtggga
gaaggcagccaccctgagcgggtgaaggtgtatggcccaggcgtggagaagacaggcctc
aaggccaacgagcctacctacttcaccgtggactgcagtgaggctgggcaaggtgatgtg
agtatcggtatcaagtgcgcccctggcgtagtgggccctgcagaagctgacatcgacttt
gacatcatcaagaatgacaatgacaccttcacagtcaagtatacacccccgggagcgggc
cgctacaccatcatggtgctgtttgccaaccaggagatccctgccagtcccttccatatt
aaggtggacccatcccatgatgccagcaaggtcaaggctgagggccctgggctgaacaga
acaggtgtggaagttgggaagcccactcacttcacggtactgaccaagggagccggcaag
gccaagttggatgtgcactttgctggggctgccaagggcgaagctgtgcgggactttgaa
atcattgacaaccatgactactcctacactgtcaagtacacagctgtccagcagggcaac
atggctgtgacagtgacctatggtggggaccctgtccccaagagcccctttgtagtgaat
gtggcacccccattggacctcagcaaagtcaaagttcaaggcttgaacagcaaggtggct
gtggggcaagaacaggcgttctctgtgaacacacgtggggctggcggtcagggccagctg
gatgtgcggatgacctcaccctctcgccgacccataccttgcaaggtggagcctgggggt
ggagctgaaacccaggctgtgcgctacatgccccctgaggaggggccctacaaggtggac
atcacctacgatggtcacccagtgcctggcagcccctttgctgtggaaggtgtcctgccc
cctgacccctccaaggtctgtgcttatggccctggtctcaagggtggactggtaggcagc
ccagcaccgttctccattgacaccaagggggcaggtaccggcggcctcgggctgactgta
gagggcccctgcgaagccaagatcgagtgccaggacaatggtgatggctcatgtgctgtc
agctacctacccacggagccgggcgagtacaccatcaacatcctatttgctgaagcccac
atcccaggctcacccttcaaggccaccatccggcccgtgtttgacccaagcaaggtgcgg
gccagtgggcctggcctggagcgtggcaaggctggcgaggcagccaccttcactgtggac
tgctcggaggcgggtgaggctgagctgaccattgagatcctgtcggatgccggcgtcaag
gctgaggtgctgatccacaacaacgcagacggcacctaccacatcacctacagcccagcc
tttcctggcacctataccattaccatcaagtatggcgggcaccctgtccccaaattcccc
acccgcgtccacgtgcagcctgctgttgacaccagtggaatcaaggtctcagggcccggg
gtggagcctcatggtgtcctgcgtgaggtgaccacagagttcactgtggatgcaagatcc
ctaacagccactggtgggaaccatgtgacagcgcgtgtactcaacccctcgggtgctaag
acagacacctatgtgacggacaatggtgatggcacctaccgagtgcagtacaccgcctat
gaagagggcgtacatctggtggaggtgctgtatgacgacgtagctgtgcccaagagcccc
ttcagagtgggcgtgacggagggctgtgaccccacccgagtgcgggccttcgggccaggc
ttggagagtggcttagtcaacaaggccaaccacttcactgtggagaccaggggagctggc
actggaggcctcggcctagccattgagggcccctcggaagccaagatgtcctgcaaagac
aataaggatggcagctgtaccgtggagtacatccccttcacccctggagactatgacgtc
aacatcaccttcggggggcggcccatcccagggagccctttccgggtgccggtgaaggac
gtggtggaccctgggaaggtgaagtgctcagggccaggtctgggggccggtgtccgggcc
cgggtaccccagaccttcacagtggactgcagccaagctggccgggccccactgcaagtg
gccgtgctgggccccacaggtgtggccgagcccgtggaggtgcttgacaatggaggtggc
acccacaccgtccactacaccccagccacggatgggccctacacggtagctgtcaagtat
gctgaccaggaggtgccacgcagccccttcaagatcaaggtgcttcctgcccacgatgcc
agcaaggtgcgggccagtggccctggcctcaatgcctctggcatccctgccagcctgcct
gtggagttcaccattgatgcccgggatgctggcgagggtttgctcaccgtccagatcctg
gatccggagggaaagcccaagaaggccaacatacgagacaacggggatggcacgtacacc
gtgtcctacctgccagacatgagtggccggtacaccatcaccatcaagtatggtggcgac
gagatcccctactcacccttccgcatccatgccctgcccactggggatgccagcaagtgt
cttgtcacagtgtccattggaggccatggcctgggtgcctgcctgggaccccgcatccag
atcggggaggagaccgtgatcacagtagatgccaaggcagcaggcaaggggaaggtgaca
tgcacggtatccacgccggatggggcggagctcgacgtggacgtggttgagaaccacgat
ggtacctttgacatctactacacagcacctgagcccggcaagtacgtcatcaccatccgc
tttggaggcgagcacatccccaacagccccttccatgtactggcgtgtgaccccatgccc
cacgtggaggagcctgctgacgtgctgcagctgccccggcccagcacctaccccacacac
tgggccacagaggagccagtggtgcctgcagagccaatggaatccatgctgaggcccttc
aacctggtcatccccttcactgtgcagaaaggggaactcacgggggaggtacggatgccc
tctgggaaaacggcccggcccaacatcaccgacaacaaggacggcaccatcacggtgaga
tatgcacccacagagaaaggcctacaccagatggggatcaagtatgacggcaaccacatc
cctggaagtcccctacagttctacgtggacgccatcaacagccgccatgtcagtgcctat
gggccaggcctgagccatggcatggtcaacaagccggcaaccttcaccattgtcaccaag
gatgctggggaagggggtctgtccctggctgtggagggcccatccaaggctgagatcacc
tgcaaggacaacaaggacggcacctgcaccgtgtcctacctgcccactgcgcccggagac
tatagcatcatcgtgcgctttgatgacaagcacatcccagggagccccttcacagccaag
atcacaggtgatgactcaatgcgcacatcacagctgaacgtgggcacctccacggatgtg
tcactgaagatcactgagagtgacctgagcctgctgaccgccagcatccgtgccccctcc
ggcaatgaggagccctgcctgttaaagcgcctgcccaaccggcacattggcatctccttc
acccccaaggaagttggggagcacgtggtgagcgtgcgcaagagtggcaagcacgtcacc
aacagccccttcaagatcttggtggggccatctgagattggggacgccagcaaggtgcgg
gtctggggcaaaggcctgtccgagggacacaccttccaggtggcggagttcatcgtggac
actcgcaatgcaggttatgggggcttggggctgagtattgaaggccccagcaaggtggac
atcaactgtgaggacatggaagacggtacatgtaaagtcacctattgccccacggagcct
ggcacctacatcatcaacatcaaatttgctgacaagcacgtgcctggaagcccattcact
gtgaaggttaccggcgaaggccgcatgaaggaaagcatcacccggcgcagacaggcgcct
tccatcgccaccatcggcagcacttgtgacctcaacctcaagatcccagggaactggttc
cagatggtgtctgcccaggagcgcctgacgcgcaccttcacgcgtagcagccacacgtac
acccgcacagagcgcacggagatcagcaagacgcggggtggggagaccaagcgcgaggtg
cgggtggaggagtccacccaggtgggtggagatcccttccctgctgtcttcggagacttc
ctgggccgggagcgcctgggctccttcggcagcatcactcggcagcaggagggtgaagcc
agttctcaggacatgactgcacaggtgaccagcccatcgggcaagatggaagccgcagag
atcgttgagggagaagacagcgcatacagtgtgcgtttcgtgccccaggagatggggccc
catacagtcactgtcaaataccgtggtcagcatgtgcctggcagcccctttcagtttact
gtggggccactgggtgaaggtggtgcccacaaagtgagggctggtggcacaggactggaa
cgaggtgtggccggtgtgccagccgagttcagcatttggactcgagaagcaggtgccggg
ggcctgtccattgctgtggagggacccagcaaggcggagattgcttttgaagaccgaaaa
gatggctcctgtggcgtctcctatgttgtccaggaaccaggtgactatgaggtctccatc
aagttcaatgacgagcacataccagacagcccctttgtggtgcctgtggcctccctctca
gatgacgctcgccgcctcaccgtcaccagcctgcaggagacagggctcaaggtgaaccag
ccagcctccttcgcggtgcagctgaatggtgctcggggcgtgatcgacgctagagtacac
acgccctcgggtgcagtggaggagtgctacgtctctgagctggacagcgacaagcacacc
atccgcttcatcccccatgagaacggcgtccactctattgatgtcaagttcaacggtgcc
cacatccccggcagtcccttcaagatccgtgttggggaacagagccaggcaggggaccca
ggcttggtgtcagcttatggtcctgggcttgagggaggcaccactggtgtatcatcagag
ttcattgtcaacaccctgaatgcgggctcaggggccctgtctgtcaccatcgacggcccc
tccaaggtgcagctagactgtcgggagtgtcctgagggccatgtggtcacttatactccc
atggcccctggcaactacctcattgccatcaagtatggtggcccccagcacatcgtgggc
agccccttcaaggccaaggtcacaggtccccggctgtctggaggccatagccttcacgaa
acatccacggttctggtggagaccgtgaccaagtcatcctccagccgcggctccagctac
agctccatccctaagttctcctcagatgccagcaaggtggtgacacggggcccagggctg
tcccaggcctttgtgggccagaagaactccttcactgtggactgcagcaaagcaggcacc
aacatgatgatggtgggcgtgcacgggcccaagaccccctgtgaggaggtgtatgtgaag
cacatggggaaccgggtatacaacgtcacctacaccgtcaaggagaaaggggactacatc
ctcatcgtcaagtggggcgacgaaagcgtccctggaagccccttcaaagtcaacgtgccc
tga

DBGET integrated database retrieval system