KEGG   Canis familiaris (dog): 482266Help
Entry
482266            CDS       T01007                                 

Gene name
FLNC
Definition
filamin C, gamma
Orthology
K04437  
filamin
Organism
cfa  Canis familiaris (dog)
Pathway
MAPK signaling pathway
Focal adhesion
Salmonella infection
Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    482266 (FLNC)
 Cellular Processes
  Cellular commiunity
   04510 Focal adhesion
    482266 (FLNC)
 Human Diseases
  Cancers
   05205 Proteoglycans in cancer
    482266 (FLNC)
  Infectious diseases
   05132 Salmonella infection
    482266 (FLNC)
Exosome [BR:cfa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   482266 (FLNC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
14
AA seq 2720 aa AA seqDB search
MMNNSGYSEAAGLGLADEVDDMPSTEKDLAEDAPWKKIQQNTFTRWCNEHLKCVGKRLTD
LQRDLSDGLRLIALLEVLSQKRMYRKFHPRPNFRQMKLENVSVALEFLEREHIKLVSIDS
KAIVDGNLKLILGLIWTLILHYSISMPMWEDEDDEDARKQTPKQRLLGWIQNKVPQLPIT
NFNRDWQDGKALGALVDNCAPGLCPDWEAWDPNQPVENAREAMQQADDWLGVPQVIAPEE
IVDPNVDEHSVMTYLSQFPKAKLKPGAPVRSKQLNPKKAIAYGPGIEPHGNTVLQPAHFT
VQTVDAGVGEVLVYIEDPEGHTEEAKVVPNNDKNRTYAVSYVPKVAGLHKVTVLFAGQNI
ERSPFEVNVGMALGDANKVSARGPGLEPMGNVANKPTYFDIYTAGAGTGDVAVVIVDPQG
RRDTVEVALEDKGDNTFRCTYRPVMEGPHTVHVAFAGAPITRSPFPVHVAEACNPNACRA
SGRGLQPKGVRVKEVADFKVFTKGAGSGELKVTVKGPKGTEEPVKVREAGDGVFECEYYP
VVPGKYVVTITWGGYAIPRSPFEVQVSPEAGTQKVRAWGPGLKTGQVGKSADFVVEAIGT
EVGTLGFSIEGPSQAKIECDDKGDGSCDVRYWPTEPGEYAVHVICDDEDIRDSPFIAHIQ
PAAPDCFPDKVKAFGPGLEPTGCIVDKPAEFTIDARAAGKGDLNLYAQDADGCPVNIMVI
PNGDGTFRCSYVPTKPIKHTIIISWGGVNVPKSPFRVNVGEGSHPERVKVYGPGVEKTGL
KANEPTYFTVDCSEAGQGDVSIGIKCAPGVVGPAEADIDFDIIKNDNDTFTVKYTPPGAG
RYTIMVLFANQEIPASPFHIKVDPSHDASKVKAEGPGLNRTGVEVGKPTHFTVLTKGAGK
AKLDVHFAGAAKGEAVRDFEIIDNHDYSYTVKYTAVQQGNMAVTVTYGGDPVPKSPFVVN
VAPPLDLSKVKVQGLNSKVAVGQEQAFSVNTRGAGGQGQLDVRMTSPSRRPIPCKVEPGG
GAETQAVRYMPPEEGPYKVDITYDGHPVPGSPFAVEGVLPPDPSKVCAYGPGLKGGLVGS
PAPFSIDTKGAGTGGLGLTVEGPCEAKIECQDNGDGSCAVSYLPTEPGEYTINILFAEAH
IPGSPFKATIRPVFDPSKVRASGPGLERGKAGEAATFTVDCSEAGEAELTIEILSDAGVK
AEVLIHNNADGTYHITYSPAFPGTYTITIKYGGHPVPKFPTRVHVQPAVDTSGIKVSGPG
VEPHGVLREVTTEFTVDARSLTATGGNHVTARVLNPSGAKTDTYVTDNGDGTYRVQYTAY
EEGVHLVEVLYDDVAVPKSPFRVGVTEGCDPTRVRAFGPGLESGLVNKANHFTVETRGAG
TGGLGLAIEGPSEAKMSCKDNKDGSCTVEYIPFTPGDYDVNITFGGRPIPGSPFRVPVKD
VVDPGKVKCSGPGLGAGVRARVPQTFTVDCSQAGRAPLQVAVLGPTGVAEPVEVLDNGGG
THTVHYTPATDGPYTVAVKYADQEVPRSPFKIKVLPAHDASKVRASGPGLNASGIPASLP
VEFTIDARDAGEGLLTVQILDPEGKPKKANIRDNGDGTYTVSYLPDMSGRYTITIKYGGD
EIPYSPFRIHALPTGDASKCLVTVSIGGHGLGACLGPRIQIGEETVITVDAKAAGKGKVT
CTVSTPDGAELDVDVVENHDGTFDIYYTAPEPGKYVITIRFGGEHIPNSPFHVLACDPMP
HVEEPADVLQLPRPSTYPTHWATEEPVVPAEPMESMLRPFNLVIPFTVQKGELTGEVRMP
SGKTARPNITDNKDGTITVRYAPTEKGLHQMGIKYDGNHIPGSPLQFYVDAINSRHVSAY
GPGLSHGMVNKPATFTIVTKDAGEGGLSLAVEGPSKAEITCKDNKDGTCTVSYLPTAPGD
YSIIVRFDDKHIPGSPFTAKITGDDSMRTSQLNVGTSTDVSLKITESDLSLLTASIRAPS
GNEEPCLLKRLPNRHIGISFTPKEVGEHVVSVRKSGKHVTNSPFKILVGPSEIGDASKVR
VWGKGLSEGHTFQVAEFIVDTRNAGYGGLGLSIEGPSKVDINCEDMEDGTCKVTYCPTEP
GTYIINIKFADKHVPGSPFTVKVTGEGRMKESITRRRQAPSIATIGSTCDLNLKIPGNWF
QMVSAQERLTRTFTRSSHTYTRTERTEISKTRGGETKREVRVEESTQVGGDPFPAVFGDF
LGRERLGSFGSITRQQEGEASSQDMTAQVTSPSGKMEAAEIVEGEDSAYSVRFVPQEMGP
HTVTVKYRGQHVPGSPFQFTVGPLGEGGAHKVRAGGTGLERGVAGVPAEFSIWTREAGAG
GLSIAVEGPSKAEIAFEDRKDGSCGVSYVVQEPGDYEVSIKFNDEHIPDSPFVVPVASLS
DDARRLTVTSLQETGLKVNQPASFAVQLNGARGVIDARVHTPSGAVEECYVSELDSDKHT
IRFIPHENGVHSIDVKFNGAHIPGSPFKIRVGEQSQAGDPGLVSAYGPGLEGGTTGVSSE
FIVNTLNAGSGALSVTIDGPSKVQLDCRECPEGHVVTYTPMAPGNYLIAIKYGGPQHIVG
SPFKAKVTGPRLSGGHSLHETSTVLVETVTKSSSSRGSSYSSIPKFSSDASKVVTRGPGL
SQAFVGQKNSFTVDCSKAGTNMMMVGVHGPKTPCEEVYVKHMGNRVYNVTYTVKEKGDYI
LIVKWGDESVPGSPFKVNVP
NT seq 8163 nt NT seq  +upstreamnt  +downstreamnt
atgatgaacaacagcggctactcggaggccgcgggcctcggcctggccgacgaggtggac
gacatgccgtccacggagaaggacctggcggaggacgcgccgtggaagaagatccagcag
aacacgttcacgcgctggtgcaacgagcacctcaagtgcgtgggcaagcgcctgaccgac
ctgcagcgcgacctcagcgacgggctgcgcctcatcgcgctgctcgaggtgctcagccag
aagcgcatgtaccgcaagttccacccgcgccccaacttccgccagatgaagctggagaac
gtgtccgtggccctcgagttcctcgagcgcgagcacatcaagctcgtgtccatcgacagc
aaggccatcgtggatggaaacctgaagctgatcctgggtctaatctggacgctgatcctg
cactactccatctccatgcccatgtgggaggatgaggatgatgaggacgcccgcaagcag
acgcccaaacagcgtctgctcggctggatccagaacaaggtgccccaactgcccatcact
aacttcaaccgtgactggcaggacggcaaggctctgggtgccctggtggacaattgcgcc
cctggcctctgccctgactgggaggcctgggaccccaaccagcctgtggagaacgcccgg
gaggccatgcagcaggcggacgactggctcggggtgccccaggtgattgcccctgaggag
attgtggatcccaacgtggatgagcattctgtcatgacctacctgtcccagttccccaag
gccaaactcaagcctggtgcccctgttcgctctaagcagctgaacccaaagaaggccatc
gcctacgggcctggcattgagccccacggcaacacggtgctgcagcctgcccacttcact
gttcagacggtggatgccggtgtgggtgaggtgctggtctacattgaggaccctgagggc
cacaccgaggaggccaaggtggttcccaacaatgacaagaaccggacctatgctgtctcc
tatgtgcctaaggttgcggggttgcacaaggtgaccgtgctctttgctggccagaacatc
gaacgcagcccttttgaggtgaacgtgggcatggccctgggggatgccaacaaggtgtcg
gcccgtggccctggcctggagcccatgggcaatgtggccaacaaacccacctactttgac
atctacactgcgggggctgggactggtgatgttgccgtggtgatcgtggacccgcagggc
cggagggacacagtggaggtggccctggaagacaagggtgataacacattccgatgcacg
tacaggcctgtgatggaggggccccacacggtgcatgtggcctttgctggtgcccccatc
acccgcagtcctttccccgtccatgtggcagaagcctgtaaccccaatgcctgccgtgcc
tctgggcggggcctgcagcccaagggtgtgcgtgtgaaagaggtggctgacttcaaggtg
ttcacgaagggtgccggcagcggagagctcaaggtcacagtcaaggggccaaagggcaca
gaggagccagtaaaggtgcgagaggctggagatggtgtgttcgagtgtgagtactaccct
gtggtgcctgggaagtacgtggtgaccatcacatggggcggctatgctatcccccgcagc
ccctttgaggtacaggtgagcccagaggcaggaacacagaaggtacgggcctggggtcct
ggcctgaaaactggccaggtgggcaagtcagccgactttgtggtggaggccattggcacg
gaggtggggacactgggcttctccattgaggggccctcgcaggccaagattgagtgtgat
gacaagggggatggctcctgcgatgtgaggtactggcccacagagcccggagagtatgct
gtgcatgtcatctgtgatgatgaggacatccgagactcccccttcattgcccacatccag
ccagccgcacccgactgctttccagacaaggtgaaggcctttgggcccggcctggagccc
acaggctgcatcgtggacaagcctgcggagttcaccattgatgctcgtgccgctggcaag
ggagacctgaatctgtatgcccaggacgctgatggctgccctgtcaacatcatggtcatt
cccaacggcgatggcaccttccgctgctcctatgtgcccaccaagcccattaaacacacc
atcatcatttcctggggaggtgtcaacgtgcccaagagccccttccgggtaaatgtggga
gaaggcagccaccctgagcgggtgaaggtgtatggcccaggcgtggagaagacaggcctc
aaggccaacgagcctacctacttcaccgtggactgcagtgaggctgggcaaggtgatgtg
agtatcggtatcaagtgcgcccctggcgtagtgggccctgcagaagctgacatcgacttt
gacatcatcaagaatgacaatgacaccttcacagtcaagtatacacccccgggagcgggc
cgctacaccatcatggtgctgtttgccaaccaggagatccctgccagtcccttccatatt
aaggtggacccatcccatgatgccagcaaggtcaaggctgagggccctgggctgaacaga
acaggtgtggaagttgggaagcccactcacttcacggtactgaccaagggagccggcaag
gccaagttggatgtgcactttgctggggctgccaagggcgaagctgtgcgggactttgaa
atcattgacaaccatgactactcctacactgtcaagtacacagctgtccagcagggcaac
atggctgtgacagtgacctatggtggggaccctgtccccaagagcccctttgtagtgaat
gtggcacccccattggacctcagcaaagtcaaagttcaaggcttgaacagcaaggtggct
gtggggcaagaacaggcgttctctgtgaacacacgtggggctggcggtcagggccagctg
gatgtgcggatgacctcaccctctcgccgacccataccttgcaaggtggagcctgggggt
ggagctgaaacccaggctgtgcgctacatgccccctgaggaggggccctacaaggtggac
atcacctacgatggtcacccagtgcctggcagcccctttgctgtggaaggtgtcctgccc
cctgacccctccaaggtctgtgcttatggccctggtctcaagggtggactggtaggcagc
ccagcaccgttctccattgacaccaagggggcaggtaccggcggcctcgggctgactgta
gagggcccctgcgaagccaagatcgagtgccaggacaatggtgatggctcatgtgctgtc
agctacctacccacggagccgggcgagtacaccatcaacatcctatttgctgaagcccac
atcccaggctcacccttcaaggccaccatccggcccgtgtttgacccaagcaaggtgcgg
gccagtgggcctggcctggagcgtggcaaggctggcgaggcagccaccttcactgtggac
tgctcggaggcgggtgaggctgagctgaccattgagatcctgtcggatgccggcgtcaag
gctgaggtgctgatccacaacaacgcagacggcacctaccacatcacctacagcccagcc
tttcctggcacctataccattaccatcaagtatggcgggcaccctgtccccaaattcccc
acccgcgtccacgtgcagcctgctgttgacaccagtggaatcaaggtctcagggcccggg
gtggagcctcatggtgtcctgcgtgaggtgaccacagagttcactgtggatgcaagatcc
ctaacagccactggtgggaaccatgtgacagcgcgtgtactcaacccctcgggtgctaag
acagacacctatgtgacggacaatggtgatggcacctaccgagtgcagtacaccgcctat
gaagagggcgtacatctggtggaggtgctgtatgacgacgtagctgtgcccaagagcccc
ttcagagtgggcgtgacggagggctgtgaccccacccgagtgcgggccttcgggccaggc
ttggagagtggcttagtcaacaaggccaaccacttcactgtggagaccaggggagctggc
actggaggcctcggcctagccattgagggcccctcggaagccaagatgtcctgcaaagac
aataaggatggcagctgtaccgtggagtacatccccttcacccctggagactatgacgtc
aacatcaccttcggggggcggcccatcccagggagccctttccgggtgccggtgaaggac
gtggtggaccctgggaaggtgaagtgctcagggccaggtctgggggccggtgtccgggcc
cgggtaccccagaccttcacagtggactgcagccaagctggccgggccccactgcaagtg
gccgtgctgggccccacaggtgtggccgagcccgtggaggtgcttgacaatggaggtggc
acccacaccgtccactacaccccagccacggatgggccctacacggtagctgtcaagtat
gctgaccaggaggtgccacgcagccccttcaagatcaaggtgcttcctgcccacgatgcc
agcaaggtgcgggccagtggccctggcctcaatgcctctggcatccctgccagcctgcct
gtggagttcaccattgatgcccgggatgctggcgagggtttgctcaccgtccagatcctg
gatccggagggaaagcccaagaaggccaacatacgagacaacggggatggcacgtacacc
gtgtcctacctgccagacatgagtggccggtacaccatcaccatcaagtatggtggcgac
gagatcccctactcacccttccgcatccatgccctgcccactggggatgccagcaagtgt
cttgtcacagtgtccattggaggccatggcctgggtgcctgcctgggaccccgcatccag
atcggggaggagaccgtgatcacagtagatgccaaggcagcaggcaaggggaaggtgaca
tgcacggtatccacgccggatggggcggagctcgacgtggacgtggttgagaaccacgat
ggtacctttgacatctactacacagcacctgagcccggcaagtacgtcatcaccatccgc
tttggaggcgagcacatccccaacagccccttccatgtactggcgtgtgaccccatgccc
cacgtggaggagcctgctgacgtgctgcagctgccccggcccagcacctaccccacacac
tgggccacagaggagccagtggtgcctgcagagccaatggaatccatgctgaggcccttc
aacctggtcatccccttcactgtgcagaaaggggaactcacgggggaggtacggatgccc
tctgggaaaacggcccggcccaacatcaccgacaacaaggacggcaccatcacggtgaga
tatgcacccacagagaaaggcctacaccagatggggatcaagtatgacggcaaccacatc
cctggaagtcccctacagttctacgtggacgccatcaacagccgccatgtcagtgcctat
gggccaggcctgagccatggcatggtcaacaagccggcaaccttcaccattgtcaccaag
gatgctggggaagggggtctgtccctggctgtggagggcccatccaaggctgagatcacc
tgcaaggacaacaaggacggcacctgcaccgtgtcctacctgcccactgcgcccggagac
tatagcatcatcgtgcgctttgatgacaagcacatcccagggagccccttcacagccaag
atcacaggtgatgactcaatgcgcacatcacagctgaacgtgggcacctccacggatgtg
tcactgaagatcactgagagtgacctgagcctgctgaccgccagcatccgtgccccctcc
ggcaatgaggagccctgcctgttaaagcgcctgcccaaccggcacattggcatctccttc
acccccaaggaagttggggagcacgtggtgagcgtgcgcaagagtggcaagcacgtcacc
aacagccccttcaagatcttggtggggccatctgagattggggacgccagcaaggtgcgg
gtctggggcaaaggcctgtccgagggacacaccttccaggtggcggagttcatcgtggac
actcgcaatgcaggttatgggggcttggggctgagtattgaaggccccagcaaggtggac
atcaactgtgaggacatggaagacggtacatgtaaagtcacctattgccccacggagcct
ggcacctacatcatcaacatcaaatttgctgacaagcacgtgcctggaagcccattcact
gtgaaggttaccggcgaaggccgcatgaaggaaagcatcacccggcgcagacaggcgcct
tccatcgccaccatcggcagcacttgtgacctcaacctcaagatcccagggaactggttc
cagatggtgtctgcccaggagcgcctgacgcgcaccttcacgcgtagcagccacacgtac
acccgcacagagcgcacggagatcagcaagacgcggggtggggagaccaagcgcgaggtg
cgggtggaggagtccacccaggtgggtggagatcccttccctgctgtcttcggagacttc
ctgggccgggagcgcctgggctccttcggcagcatcactcggcagcaggagggtgaagcc
agttctcaggacatgactgcacaggtgaccagcccatcgggcaagatggaagccgcagag
atcgttgagggagaagacagcgcatacagtgtgcgtttcgtgccccaggagatggggccc
catacagtcactgtcaaataccgtggtcagcatgtgcctggcagcccctttcagtttact
gtggggccactgggtgaaggtggtgcccacaaagtgagggctggtggcacaggactggaa
cgaggtgtggccggtgtgccagccgagttcagcatttggactcgagaagcaggtgccggg
ggcctgtccattgctgtggagggacccagcaaggcggagattgcttttgaagaccgaaaa
gatggctcctgtggcgtctcctatgttgtccaggaaccaggtgactatgaggtctccatc
aagttcaatgacgagcacataccagacagcccctttgtggtgcctgtggcctccctctca
gatgacgctcgccgcctcaccgtcaccagcctgcaggagacagggctcaaggtgaaccag
ccagcctccttcgcggtgcagctgaatggtgctcggggcgtgatcgacgctagagtacac
acgccctcgggtgcagtggaggagtgctacgtctctgagctggacagcgacaagcacacc
atccgcttcatcccccatgagaacggcgtccactctattgatgtcaagttcaacggtgcc
cacatccccggcagtcccttcaagatccgtgttggggaacagagccaggcaggggaccca
ggcttggtgtcagcttatggtcctgggcttgagggaggcaccactggtgtatcatcagag
ttcattgtcaacaccctgaatgcgggctcaggggccctgtctgtcaccatcgacggcccc
tccaaggtgcagctagactgtcgggagtgtcctgagggccatgtggtcacttatactccc
atggcccctggcaactacctcattgccatcaagtatggtggcccccagcacatcgtgggc
agccccttcaaggccaaggtcacaggtccccggctgtctggaggccatagccttcacgaa
acatccacggttctggtggagaccgtgaccaagtcatcctccagccgcggctccagctac
agctccatccctaagttctcctcagatgccagcaaggtggtgacacggggcccagggctg
tcccaggcctttgtgggccagaagaactccttcactgtggactgcagcaaagcaggcacc
aacatgatgatggtgggcgtgcacgggcccaagaccccctgtgaggaggtgtatgtgaag
cacatggggaaccgggtatacaacgtcacctacaccgtcaaggagaaaggggactacatc
ctcatcgtcaagtggggcgacgaaagcgtccctggaagccccttcaaagtcaacgtgccc
tga

DBGET integrated database retrieval system