KEGG   Canis familiaris (dog): 482505Help
Entry
482505            CDS       T01007                                 

Gene name
CYP4X1
Definition
cytochrome P450, family 4, subfamily X, polypeptide 1 (EC:1.14.14.1)
Orthology
K07428  
cytochrome P450, family 4, subfamily X [EC:1.14.14.1]
Organism
cfa  Canis familiaris (dog)
Pathway
Serotonergic synapse
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Organismal Systems
  Nervous system
   04726 Serotonergic synapse
    482505 (CYP4X1)
Enzymes [BR:cfa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     482505 (CYP4X1)
Cytochrome P450 [BR:cfa00199]
 Cytochrome P450, animal type
  CYP4 family
   482505 (CYP4X1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
15
AA seq 507 aa AA seqDB search
MESSWLETRWARPLYLAFAFCLALGLLQAIKLYLRRLRLLRDLCPFPAPPTHWFYGHQKL
LQDGKIEKLEELVEKYPCAFPYWVGPFQAFFYIYDPDYAKTFLGRTDPKSKYLYKFLIPC
LGNGLVNLEGSKWFQHRCLLTPGFNVNILKSYIKVMAHSVNTMLGKWEKICGTQDTVVEV
FEHINLMTLDVLMKCAFSQETNCQISSNHDLYVKTTFEASKINFYRLYSFLHHHDIIFKF
SPQGHRLQELVKILHQYTEKVIQDRKKLLKDEKKHGNTQKRKDQDYLDIILSAQAENGNS
FSDTDLRSEVNTFILAGHDTMAGSISWLLYHLALNPEHQERCRQEIRGILRDRSSITWDQ
LGEMSYTTMCIKESLRLAPPIPSISRELSKPITFPDGRSLPAGITVVLSIWGLHHNSAIW
ENPKVFDPLRFSQENSDQRHTHSFLPFSAGPRNCIGQHFAMVKLKVAIALILLHFKVSPD
PTRPLVFLHQIVLKPKNGVHLHLKKLP
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atggagtcgtcctggctggagacgcgctgggcgcggcccttgtacctggccttcgccttc
tgcctggccctggggctgctgcaggccatcaagctctacctgcggaggctgcggctgctg
cgagacctgtgccccttccccgcgccccccacccactggttctacgggcaccagaagtta
cttcaggatggtaaaatagagaaacttgaggagcttgttgaaaaatacccttgtgccttt
ccttactgggttgggccttttcaggcatttttctatatctacgacccagactacgcaaag
acatttctgggcagaacagatcccaagtccaagtacctgtacaagttcttgattccatgt
cttggaaacggactagtgaatctggaaggatccaagtggttccagcaccgctgcctacta
actcctgggttcaatgttaacatcttgaaatcatacatcaaggtgatggcccattctgtg
aatacaatgctgggtaagtgggagaagatttgtggcactcaggacacagttgtggaggtc
tttgagcacatcaacctgatgaccttggatgtactgatgaaatgcgctttcagccaggag
accaactgccagataagcagcaaccatgatctttatgttaaaacaacgtttgaagccagt
aaaataaacttttaccgcttgtacagtttcttacatcaccatgacataattttcaaattc
agccctcagggccatcgcttacaggagctggtcaaaattctccatcagtacacagaaaag
gtaatccaggatagaaagaaattactcaaagatgagaagaagcatggcaacactcagaaa
cggaaggaccaggattatctggatattatcctttctgcccaggctgaaaatggcaacagc
ttctcagatactgacctacggtctgaggtgaacacattcatcttggcagggcatgacacc
atggcagggagcatttcctggctcctctaccacctggctctgaaccctgagcatcaggag
agatgccggcaggagatcaggggcatcctgagggacaggtcttctatcacatgggaccag
ctgggtgagatgtcgtataccaccatgtgcatcaaggagtcactccgactggcgcctcca
atcccatccatttccagagagctcagcaagcccattaccttcccagatggacgctccttg
cctgcaggaataaccgtggttctcagtatttggggccttcaccataactctgccatctgg
gaaaacccaaaggtctttgaccccttgaggttttctcaggagaattctgatcagagacac
acccactccttcttaccattctcggctggaccaaggaactgtatcgggcagcattttgcc
atggtcaagctaaaggtggccattgccttgattctgctccacttcaaggtgtctccagac
cccaccagacctcttgtcttcttgcaccagattgtcctcaaacccaagaatggggtccac
ttgcacctgaagaaactcccctaa

DBGET integrated database retrieval system