KEGG   Canis familiaris (dog): 482505Help
Entry
482505            CDS       T01007                                 

Gene name
CYP4X1
Definition
cytochrome P450, family 4, subfamily X, polypeptide 1 (EC:1.14.14.1)
Orthology
K07428  
cytochrome P450, family 4, subfamily X [EC:1.14.14.1]
Organism
cfa  Canis familiaris (dog)
Pathway
Serotonergic synapse
Class
Organismal Systems; Nervous system; Serotonergic synapse [PATH:cfa04726]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
15
AA seq 507 aa AA seqDB search
MESSWLETRWARPLYLAFAFCLALGLLQAIKLYLRRLRLLRDLCPFPAPPTHWFYGHQKL
LQDGKIEKLEELVEKYPCAFPYWVGPFQAFFYIYDPDYAKTFLGRTDPKSKYLYKFLIPC
LGNGLVNLEGSKWFQHRCLLTPGFNVNILKSYIKVMAHSVNTMLGKWEKICGTQDTVVEV
FEHINLMTLDVLMKCAFSQETNCQISSNHDLYVKTTFEASKINFYRLYSFLHHHDIIFKF
SPQGHRLQELVKILHQYTEKVIQDRKKLLKDEKKHGNTQKRKDQDYLDIILSAQAENGNS
FSDTDLRSEVNTFILAGHDTMAGSISWLLYHLALNPEHQERCRQEIRGILRDRSSITWDQ
LGEMSYTTMCIKESLRLAPPIPSISRELSKPITFPDGRSLPAGITVVLSIWGLHHNSAIW
ENPKVFDPLRFSQENSDQRHTHSFLPFSAGPRNCIGQHFAMVKLKVAIALILLHFKVSPD
PTRPLVFLHQIVLKPKNGVHLHLKKLP
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atggagtcgtcctggctggagacgcgctgggcgcggcccttgtacctggccttcgccttc
tgcctggccctggggctgctgcaggccatcaagctctacctgcggaggctgcggctgctg
cgagacctgtgccccttccccgcgccccccacccactggttctacgggcaccagaagtta
cttcaggatggtaaaatagagaaacttgaggagcttgttgaaaaatacccttgtgccttt
ccttactgggttgggccttttcaggcatttttctatatctacgacccagactacgcaaag
acatttctgggcagaacagatcccaagtccaagtacctgtacaagttcttgattccatgt
cttggaaacggactagtgaatctggaaggatccaagtggttccagcaccgctgcctacta
actcctgggttcaatgttaacatcttgaaatcatacatcaaggtgatggcccattctgtg
aatacaatgctgggtaagtgggagaagatttgtggcactcaggacacagttgtggaggtc
tttgagcacatcaacctgatgaccttggatgtactgatgaaatgcgctttcagccaggag
accaactgccagataagcagcaaccatgatctttatgttaaaacaacgtttgaagccagt
aaaataaacttttaccgcttgtacagtttcttacatcaccatgacataattttcaaattc
agccctcagggccatcgcttacaggagctggtcaaaattctccatcagtacacagaaaag
gtaatccaggatagaaagaaattactcaaagatgagaagaagcatggcaacactcagaaa
cggaaggaccaggattatctggatattatcctttctgcccaggctgaaaatggcaacagc
ttctcagatactgacctacggtctgaggtgaacacattcatcttggcagggcatgacacc
atggcagggagcatttcctggctcctctaccacctggctctgaaccctgagcatcaggag
agatgccggcaggagatcaggggcatcctgagggacaggtcttctatcacatgggaccag
ctgggtgagatgtcgtataccaccatgtgcatcaaggagtcactccgactggcgcctcca
atcccatccatttccagagagctcagcaagcccattaccttcccagatggacgctccttg
cctgcaggaataaccgtggttctcagtatttggggccttcaccataactctgccatctgg
gaaaacccaaaggtctttgaccccttgaggttttctcaggagaattctgatcagagacac
acccactccttcttaccattctcggctggaccaaggaactgtatcgggcagcattttgcc
atggtcaagctaaaggtggccattgccttgattctgctccacttcaaggtgtctccagac
cccaccagacctcttgtcttcttgcaccagattgtcctcaaacccaagaatggggtccac
ttgcacctgaagaaactcccctaa

DBGET integrated database retrieval system